Retinol Binding Protein 5, Cellular (RBP5) (AA 1-135) antibody

Details for Product No. ABIN949709
Antigen
  • RBP5
  • CRBP-III
  • CRBP3
  • CRBPIII
  • CRABP1
  • retinol binding protein 5
  • RBP5
Epitope
AA 1-135
18
11
10
9
2
1
Reactivity
Human
51
13
10
9
1
Host
Mouse
63
10
9
Clonality (Clone)
Monoclonal ()
Conjugate
Un-conjugated
12
8
1
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
55
46
39
17
15
12
8
6
4
3
1
1
Options
Purpose Mouse monoclonal antibody raised against a full-length recombinant RBP5.
Immunogen

immunogen: RBP5 (NP_113679.1, 1 a.a. ~ 135 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR

Clone 2D1
Isotype IgG2a kappa
Cross-Reactivity Human
Antigen
Alternative Name RBP5 (RBP5 Antibody Abstract)
Background Full Gene Name: retinol binding protein 5, cellular
Synonyms: CRBP-III,CRBP3,CRBPIII
Gene ID 83758
NCBI Accession NP_113679, NM_031491
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Retinol Binding Protein 5, Cellular (RBP5) (AA 1-135) antibody (ABIN949709) Western Blot analysis of RBP5 expression in transfected 293T cell line by RBP5 monocl...
Image no. 2 for anti-Retinol Binding Protein 5, Cellular (RBP5) (AA 1-135) antibody (ABIN949709) Western Blot detection against Immunogen (42.3 KDa) .
Did you look for something else?