Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

ELOF1 antibody (Elongation Factor 1 Homolog) (AA 1-83) Primary Antibody

ELOF1 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 4F6 unconjugated
Catalog No. ABIN949733
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target See all ELOF1 Antibodies
    ELOF1
    Binding Specificity
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    AA 1-83
    Reactivity
    • 18
    • 15
    • 15
    • 6
    • 4
    • 4
    • 4
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    Human
    Host
    • 18
    Mouse
    Clonality
    • 18
    Monoclonal
    Conjugate
    • 11
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This ELOF1 antibody is un-conjugated
    Application
    • 13
    • 4
    • 3
    • 1
    • 1
    ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a full-length recombinant ELOF1.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: ELOF1 (NP_115753.1, 1 a.a. ~ 83 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ

    Clone
    4F6
    Isotype
    IgG2a kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    ELOF1
    Alternative Name
    ELOF1 (ELOF1 Products)
    Synonyms
    1110011K10Rik, ELF1, ELF1 homolog, elongation factor 1, elongation factor 1 homolog, Elof1, ELOF1
    Background
    Full Gene Name: elongation factor 1 homolog (S. cerevisiae)
    Synonyms: ELF1
    Gene ID
    84337
    NCBI Accession
    NP_115753, NM_032377
You are here:
help Support