ELOF1 antibody (Elongation Factor 1 Homolog) (AA 1-83)

Catalog No. ABIN949733

Product Details anti-ELOF1 Antibody

Target: ELOF1

Binding Specificity: AA 1-83

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This ELOF1 antibody is un-conjugated

Application: ELISA, Western Blotting (WB)

Purpose: Mouse monoclonal antibody raised against a full-length recombinant ELOF1.

Cross-Reactivity: Human

Immunogen:

immunogen: ELOF1 (NP_115753.1, 1 a.a. ~ 83 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ

Clone: 4F6

Isotype: IgG2a kappa

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions: For Research Use only

Handling

Buffer: In 1x PBS, pH 7.4

Handling Advice: Aliquot to avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Target Details for ELOF1

Target: ELOF1

Alternative Name: ELOF1 (ELOF1 Products)

Synonyms: 1110011K10Rik, ELF1, ELF1 homolog, elongation factor 1, elongation factor 1 homolog, Elof1, ELOF1

Background: Full Gene Name: elongation factor 1 homolog (S. cerevisiae)
Synonyms: ELF1

Gene ID: 84337

NCBI Accession: NP_115753, NM_032377