Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1109335

Tripartite Motif Containing 32 (TRIM32) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HT2A, BBS11, TATIP, LGMD2H, 3f3, Zfp117, 1810045E12Rik, TRIM32
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio)
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN1109335
Quantity 50 µg
Price
390.50 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 6 to 8 Business Days
Immunogen The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32.
Sequence GFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKE
Purification Purified on peptide immunoaffinity column
Alternative Name TRIM32 / HT2A
Background TRIM32 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc- binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM32 localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B- box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.
Alternate names: 72 kDa Tat-interacting protein, Tripartite motif-containing protein 32, Zinc finger protein HT2A
Gene ID 22954
NCBI Accession NP_036342
Restrictions For Research Use only
Reconstitution Add 50 µL of distilled water
Handling Advice Avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
Expiry Date 12 months
Background publications Chiang, Beck, Yen et al.: "Homozygosity mapping with SNP arrays identifies TRIM32, an E3 ubiquitin ligase, as a Bardet-Biedl syndrome gene (BBS11)." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 16, pp. 6287-92, 2006 (PubMed).

Alternatives for antigen "Tripartite Motif Containing 32 (TRIM32)", type "Antibodies"
Hosts (26), (4)
Reactivities (29), (17), (17), (3), (3), (2)
Applications (20), (10), (10), (6), (6), (2), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (2), (2), (1), (1)
Beacon