Caspase 3 antibody (AA 183-277) (Biotin)
-
- Target See all Caspase 3 (CASP3) Antibodies
- Caspase 3 (CASP3)
-
Binding Specificity
- AA 183-277
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Caspase 3 antibody is conjugated to Biotin
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), ELISA
- Sequence
- MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF- ACHKIPVE ADFLYAYSTA PGYYSWRNSK DGSWFIQSLC AMLKQYADKL EFMHILTRVN RKVATEFESF SFDATFHAKK QIPCIVSMLT KELYFYH
- Specificity
- It has been selected for its ability to recognize CASP3 in immunohistochemical staining and Western blotting.
- Purification
- Affinity Chromatography
- Immunogen
-
Recombinant CASP3 expressed in E.coli.
The antibody is a rabbit polyclonal antibody raised against CASP3 conjugated to biotin. - Isotype
- IgG
- Top Product
- Discover our top product CASP3 Primary Antibody
-
-
- Application Notes
-
Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Optimal working dilutions must be determined by end user. - Comment
-
Content: The quality control contains recombinant CASP3 (Ala183~His277) disposed in loading buffer.
Usage: 10 µL per well when 3,3'-Diaminobenzidine(DAB) as the substrate. 5 µL per well when used in enhanced chemilumescent (ECL).
Note: The quality control is specifically manufactured as the positive control.Not used for other purposes.
Loading Buffer: 100 mM Tris(pH8.8), 2 % SDS, 200 mM NaCl, 50 % glycerol,BPB 0.01 % , NaN3 0.02 % . - Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- Supplied as solution form in PBS, pH7.4, containing 0.02 % NaN3, 50 % glycerol.
- Preservative
- Sodium azide
- Precaution of Use
- WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
- Handling Advice
- Avoid repeated freeze/thaw cycles
- Storage
- 4 °C
- Storage Comment
- Store at 2-8 °C for one month. Aliquot and store at -80 °C for 12 months.
- Expiry Date
- 12 months
-
- Target
- Caspase 3 (CASP3)
- Abstract
- CASP3 Products
- Synonyms
- CPP32 antibody, CPP32B antibody, SCA-1 antibody, A830040C14Rik antibody, AC-3 antibody, Apopain antibody, CC3 antibody, Caspase-3 antibody, Lice antibody, Yama antibody, mldy antibody, xcpp32 antibody, casp3 antibody, zgc:100890 antibody, CASP-3 antibody, caspase-3 antibody, caspase 3 antibody, caspase 3 S homeolog antibody, caspase 3, apoptosis-related cysteine peptidase a antibody, caspase 3, apoptosis-related cysteine peptidase antibody, CASP3 antibody, Casp3 antibody, casp3.S antibody, casp3a antibody
- Pathways
- Apoptosis, Caspase Cascade in Apoptosis, Sensory Perception of Sound, ER-Nucleus Signaling, Positive Regulation of Endopeptidase Activity, Activated T Cell Proliferation
-