Did you know that you can buy products from over 140 different suppliers from us?

General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2) (Middle Region) antibody

Details for Product No. ABIN182367
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RAP30, btf4, gtf2f2.1, tf2f2, tfiif, GTF2F2, Afu8g05490, An16g07220, AO090005000596, 1110031C13Rik, AI326315, Rap30, BTF4, TF2F2, TFIIF, gtf2f2, wu:fb39a05, zgc:86775
Epitope
Middle Region
(9), (8), (3), (3), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(23), (7), (7), (5), (4), (4), (4), (4)
Host
Rabbit
(21), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(23), (9), (6), (3), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182367
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human GTF2F2
Sequence IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKE DGKRARADKQ
Predicted Reactivity Dog : 100 %, Mouse : 100 %, Rat : 100 %, Chicken : 90 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against GTF2F2. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name GTF2F2
Background GTF2F2 synergizes with HIV-1 Tat and the cellular coactivator Tat-SF1 during Tat-mediated transactivation of the HIV-1 LTR promoter.
Molecular Weight 28 kDa
Gene ID 2963
NCBI Accession NM_004128, NP_004119
UniProt P13984
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 249 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2) (Middle Region) antibody anti-General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2) (Middle Region) antibody
anti-General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2) (Middle Region) antibody (2) anti-General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2) (Middle Region) antibody (Image 2)
Background publications Heng, Xiao, Shi et al.: "Genes encoding general initiation factors for RNA polymerase II transcription are dispersed in the human genome." in: Human molecular genetics, Vol. 3, Issue 1, pp. 61-4, 1994 (PubMed).

Validation Images
back to top