Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182367

General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms gtf2f2, wu:fb39a05, zgc:86775, RAP30, btf4, gtf2f2.1, tf2f2, tfiif, BTF4, TF2F2, TFIIF, GTF2F2, Afu8g05490, An16g07220, AO090005000596
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182367
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the middle region of human GTF2F2
Sequence IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKE DGKRARADKQ
Predicted Reactivity Dog : 100%, Mouse : 100%, Rat : 100%, Chicken : 92%, Zebrafish : 76%
Characteristics This is a rabbit polyclonal antibody against GTF2F2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name GTF2F2
Background GTF2F2 synergizes with HIV-1 Tat and the cellular coactivator Tat-SF1 during Tat-mediated transactivation of the HIV-1 LTR promoter.
Molecular Weight 28kDa
Gene ID 2963
NCBI Accession NP_004119, NM_004128
UniProt P13984
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GTF2F2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Heng, Xiao, Shi et al.: "Genes encoding general initiation factors for RNA polymerase II transcription are dispersed in the human genome." in: Human molecular genetics, Vol. 3, Issue 1, pp. 61-4, 1994 (PubMed).

Alternatives for antigen "General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2)", type "Antibodies"
Hosts (13), (2)
Reactivities (15), (7), (7), (5), (4), (4), (4), (4)
Applications (15), (5), (3), (3), (1)
Epitopes (3), (3), (3), (2), (1)
Beacon