Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182549

RuvB-Like 2 (E. Coli) (RUVBL2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ECP51, INO80J, REPTIN, RVB2, TIH2, TIP48, TIP49B, mp47, p47, reptin, zreptin, wu:fi25f01, tip48, xReptin, MGC52995, rvb2, ecp51, cgi-46, tip49b, MGC69398, RUVBL2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182549
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RUVBL2 antibody: synthetic peptide directed towards the N terminal of human RUVBL2
Sequence IDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDK VQAGDVITID
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, African clawed frog : 92%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against RUVBL2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name RUVBL2
Background RUVBL2 encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities.
Molecular Weight 51kDa
Gene ID 10856
NCBI Accession NP_006657, NM_006666
UniProt Q9Y230
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RUVBL2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Bauer, Chauvet, Huber et al.: "Pontin52 and reptin52 function as antagonistic regulators of beta-catenin signalling activity." in: The EMBO journal, Vol. 19, Issue 22, pp. 6121-30, 2000 (PubMed).

Alternatives for antigen "RuvB-Like 2 (E. Coli) (RUVBL2)", type "Antibodies"
Hosts (20), (8)
Reactivities (27), (8), (6), (3), (2), (2), (1), (1)
Applications (26), (10), (6), (6), (6), (4), (2), (1)
Epitopes (3), (3), (2), (2), (1), (1)
Beacon