Did you know that you can buy products from over 140 different suppliers from us?

RuvB-Like 2 (E. Coli) (RUVBL2) (N-Term) antibody

Details for Product No. ABIN182549
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ECP51, INO80J, REPTIN, RVB2, TIH2, TIP48, TIP49B, mp47, p47, reptin, zreptin, wu:fi25f01, tip48, xReptin, MGC52995, rvb2, ecp51, cgi-46, tip49b, MGC69398, RUVBL2
Epitope
N-Term
(8), (3), (3), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
(35), (8), (7), (3), (2), (2), (1), (1)
Host
Rabbit
(28), (8)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(32), (12), (11), (8), (8), (4), (4), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182549
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RUVBL2
Sequence IDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDK VQAGDVITID
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, African clawed frog : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against RUVBL2. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name RUVBL2
Background RUVBL2 encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities.
Molecular Weight 51 kDa
Gene ID 10856
NCBI Accession NM_006666, NP_006657
UniProt Q9Y230
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 463 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-RuvB-Like 2 (E. Coli) (RUVBL2) (N-Term) antibody WB Suggested Anti-RUVBL2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
anti-RuvB-Like 2 (E. Coli) (RUVBL2) (N-Term) antibody (2) anti-RuvB-Like 2 (E. Coli) (RUVBL2) (N-Term) antibody (Image 2)
Background publications Bauer, Chauvet, Huber et al.: "Pontin52 and reptin52 function as antagonistic regulators of beta-catenin signalling activity." in: The EMBO journal, Vol. 19, Issue 22, pp. 6121-30, 2000 (PubMed).

Hosts (28), (8)
Reactivities (35), (8), (7), (3), (2), (2), (1), (1)
Applications (32), (12), (11), (8), (8), (4), (4), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (8), (3), (3), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182549
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top