Sirtuin 3 (SIRT3) (C-Term) antibody

Details for Product No. ABIN182557
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms SIR2L3, zgc:158774, 2310003L23Rik, AI848213, Sir2l3, sirtuin
Epitope
C-Term
(20), (5), (5), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(72), (35), (27), (13), (12), (2), (1), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(67), (8), (7), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(6), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(75), (50), (16), (14), (12), (10), (7), (3), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN182557
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human SIRT3
Sequence VGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLV QRETGKLDGP
Predicted Reactivity Bovine : 100 %, Human : 100 %, Rabbit : 100 %, Horse : 80 %, Mouse : 80 %, Dog : 70 %, Guinea pig : 70 %, Rat : 70 %
Characteristics This is a rabbit polyclonal antibody against SIRT3. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name SIRT3
Background The SIRT3 gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT3 encodes a protein that is included in class I of the sirtuin family.
Molecular Weight 28 kDa
Gene ID 23410
NCBI Accession NM_001017524, NP_001017524
UniProt Q9NTG7
Research Area Cancer, Proteases
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 257 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Sirtuin 3 (SIRT3) (C-Term) antibody anti-Sirtuin 3 (SIRT3) (C-Term) antibody
Background publications Onyango, Celic, McCaffery et al.: "SIRT3, a human SIR2 homologue, is an NAD-dependent deacetylase localized to mitochondria." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 21, pp. 13653-8, 2002 (PubMed).

Hosts (67), (8), (7), (7)
Reactivities (72), (35), (27), (13), (12), (2), (1), (1), (1), (1), (1), (1), (1)
Applications (75), (50), (16), (14), (12), (10), (7), (3), (3), (2), (1)
Conjugates (6), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (20), (5), (5), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
back to top