Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182557

Sirtuin 3 (SIRT3) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SIR2L3, zgc:158774, 2310003L23Rik, AI848213, Sir2l3, sirtuin
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182557
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SIRT3 antibody: synthetic peptide directed towards the C terminal of human SIRT3
Sequence VGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLV QRETGKLDGP
Predicted Reactivity Bovine : 100%, Human : 100%, Rabbit : 100%, Horse : 85%, Mouse : 85%, Dog : 78%, Guinea pig : 78%, Rat : 78%
Characteristics This is a rabbit polyclonal antibody against SIRT3. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name SIRT3
Background The SIRT3 gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT3 encodes a protein that is included in class I of the sirtuin family.
Molecular Weight 28kDa
Gene ID 23410
NCBI Accession NP_001017524, NM_001017524
UniProt Q9NTG7
Research Area Cancer, Proteases
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SIRT3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Onyango, Celic, McCaffery et al.: "SIRT3, a human SIR2 homologue, is an NAD-dependent deacetylase localized to mitochondria." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 21, pp. 13653-8, 2002 (PubMed).

Alternatives for antigen "Sirtuin 3 (SIRT3)", type "Antibodies"
Hosts (61), (9), (8), (4)
Reactivities (69), (32), (24), (13), (12), (3), (1), (1), (1), (1), (1), (1), (1)
Applications (68), (42), (12), (11), (10), (7), (4), (3), (2), (1), (1)
Conjugates (6), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (20), (6), (5), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon