Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182588

Chromobox Homolog 5 (CBX5) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HP1, HP1A, 2610029O15Rik, C75991, Hp1a, Hp1alpha, id:ibd2026, wu:fc63e02, wu:fe47g12, wu:fi03h05, zgc:158601, CBX5, cbx5, MGC64354
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182588
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CBX5 antibody: synthetic peptide directed towards the middle region of human CBX5
Sequence KYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKRE QSNDIARGFE
Predicted Reactivity Bovine : 100%, Human : 100%, Sheep : 100%, Dog : 92%, Mouse : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against CBX5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name CBX5
Background CBX5 is a methyl-lysine binding protein localized at heterochromatin sites, where it mediates gene silencing.
Molecular Weight 22kDa
Gene ID 23468
NCBI Accession NP_036249, NM_012117
UniProt P45973
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CBX5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Fujita, Watanabe, Ichimura et al.: "Methyl-CpG binding domain 1 (MBD1) interacts with the Suv39h1-HP1 heterochromatic complex for DNA methylation-based transcriptional repression." in: The Journal of biological chemistry, Vol. 278, Issue 26, pp. 24132-8, 2003 (PubMed).

Alternatives for antigen "Chromobox Homolog 5 (CBX5)", type "Antibodies"
Hosts (92), (12), (8)
Reactivities (103), (50), (32), (31), (26), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Applications (77), (43), (30), (22), (19), (7), (6), (5), (2), (1), (1)
Conjugates (5), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (1), (1)
Epitopes (12), (12), (12), (6), (5), (5), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Beacon