Chromobox Homolog 5 (CBX5) (Middle Region) antibody

Details for Product No. ABIN182588
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms HP1, HP1A, 2610029O15Rik, C75991, Hp1a, Hp1alpha, id:ibd2026, wu:fc63e02, wu:fe47g12, wu:fi03h05, zgc:158601, CBX5, cbx5, MGC64354
Epitope
Middle Region
(15), (12), (12), (8), (7), (7), (5), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(106), (51), (33), (29), (24), (2), (1)
Host
Rabbit
(94), (14), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(78), (49), (30), (28), (17), (8), (7), (4), (3)
Pubmed 1 reference available
Catalog no. ABIN182588
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CBX5
Sequence KYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKRE QSNDIARGFE
Predicted Reactivity Bovine : 100 %, Human : 100 %, Sheep : 100 %, Dog : 90 %, Mouse : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against CBX5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name CBX5
Background CBX5 is a methyl-lysine binding protein localized at heterochromatin sites, where it mediates gene silencing.
Molecular Weight 22 kDa
Gene ID 23468
NCBI Accession NM_012117, NP_036249
UniProt P45973
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 191 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromobox Homolog 5 (CBX5) (Middle Region) antibody WB Suggested Anti-CBX5 Antibody Titration: 1.25ug/ml
Positive Control: Human brain
anti-Chromobox Homolog 5 (CBX5) (Middle Region) antibody (2) anti-Chromobox Homolog 5 (CBX5) (Middle Region) antibody (Image 2)
Background publications Fujita, Watanabe, Ichimura et al.: "Methyl-CpG binding domain 1 (MBD1) interacts with the Suv39h1-HP1 heterochromatic complex for DNA methylation-based transcriptional repression." in: The Journal of biological chemistry, Vol. 278, Issue 26, pp. 24132-8, 2003 (PubMed).

Hosts (94), (14), (7)
Reactivities (106), (51), (33), (29), (24), (2), (1)
Applications (78), (49), (30), (28), (17), (8), (7), (4), (3)
Conjugates (4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1), (1)
Epitopes (15), (12), (12), (8), (7), (7), (5), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
back to top