Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182614

Checkpoint Kinase 1 (CHEK1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CHK1, Chk1, rad27, C85740, CHEK1, chk1, id:ibd2720, zgc:56093, An08g10320, AO090003000441
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182614
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CHEK1 antibody: synthetic peptide directed towards the middle region of human CHEK1
Sequence WSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPW KKIDSAPLAL
Predicted Reactivity Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Bovine : 92%, Chicken : 92%, Guinea pig : 92%, Pig : 92%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against CHEK1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name CHEK1
Background CHEK1 is required during normal S phase to avoid aberrantly increased initiation of DNA replication, thereby protecting against DNA breakage. Its expression is dispensable for somatic cell death and critical for sustaining G2 DNA damage checkpoint.
Molecular Weight 54kDa
Gene ID 1111
NCBI Accession NP_001265, NM_001274
UniProt O14757
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CHEK1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Krämer, Mailand, Lukas et al.: "Centrosome-associated Chk1 prevents premature activation of cyclin-B-Cdk1 kinase." in: Nature cell biology, Vol. 6, Issue 9, pp. 884-91, 2004 (PubMed).

Alternatives for antigen "Checkpoint Kinase 1 (CHEK1)", type "Antibodies"
Hosts (290), (37), (11), (5)
Reactivities (332), (126), (123), (36), (25), (24), (13), (4), (3), (2), (1), (1), (1)
Applications (247), (136), (66), (65), (50), (37), (21), (19), (7), (3), (3), (2), (1)
Conjugates (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5)
Epitopes (39), (39), (31), (26), (13), (7), (6), (6), (5), (5), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon