Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Checkpoint Kinase 1 (CHEK1) antibody

Antigen

Checkpoint Kinase 1 (CHEK1)
Synonyms CHK1, Chk1, rad27, C85740, CHEK1, LOC398191, chk1, chek1
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Zebrafish, Xenopus laevis
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN182614
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Checkpoint Kinase 1 (CHEK1) antibody

anti-Checkpoint Kinase 1 (CHEK1) antibody (2)

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name CHK1
Gene ID CHEK1
UniProt O14757
Immunogen The immunogen for anti-CHEK1 antibody: synthetic peptide directed towards the middle region of human CHEK1
Sequence WSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPW KKIDSAPLAL
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CHEK1 antibody concentration is 1 mg/ml.
Description CHEK1 is required during normal S phase to avoid aberrantly increased initiation of DNA replication, thereby protecting against DNA breakage. Its expression is dispensable for somatic cell death and critical for sustaining G2 DNA damage checkpoint.
Characteristics Antigen Size: 476 amino acids
Molecular Weight 54kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-CHEK1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Kinases/Phosphatases, Cell Cycle
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Krämer, Mailand, Lukas et al.: "Centrosome-associated Chk1 prevents premature activation of cyclin-B-Cdk1 kinase." in: Nature cell biology, Vol. 6, Issue 9, pp. 884-91, 2004 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Checkpoint Kinase 1 (CHEK1)", type "Antibodies"
Hosts Rabbit (173), Mouse (20), Goat (6), Sheep (4)
Reactivities Human (192), Rat (Rattus) (81), Mouse (Murine) (70), Horse (Equine) (10), Cow (Bovine) (8), Chicken (7), Dog (Canine) (6), Pig (Porcine) (6), Monkey (2), Yeast (Saccharomyces cerevisiae) (2), Cat (Feline) (1), Rabbit (1), Xenopus laevis (1), Yeast (1), Zebrafish (1), Zebrafish (Danio rerio) (1)
Applications Western Blotting (WB) (129), ELISA (81), Immunofluorescence (IF) (60), Immunohistochemistry (IHC) (42), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (32), Immunoprecipitation (IP) (15), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (6), Immunocytochemistry (ICC) (5), Dot Blot (Dot) (2), Flow Cytometry (FACS) (2), Immunoelectron Microscopy (IEM) (2)
Conjugates Alexa Fluor 350 (5), Alexa Fluor 488 (5), Alexa Fluor 555 (5), Alexa Fluor 647 (5), PE,Cy5.5 (4), Biotin (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), HRP (2), PE (2), PE,Cy3 (1), PE,Cy5 (1), PE,Cy7 (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes pSer317 (23), pSer280 (20), Ser296 (17), pSer345 (16), Internal Region (7), pSer296 (7), C-Term (6), Ser280 (4), AA 312-327 (3), N-Term (3), Center (2), AA 1-474 (1), AA 250-300 (1), AA 309-321 (1), Middle Region (1), pSer286 (1), pSer301 (1), pThr14 (1), pThr29 (1)