Mesenchyme Homeobox 2 (MEOX2) (N-Term) antibody

Details for Product No. ABIN182641
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms GAX, MOX2, Gax, Mox2, Mox-2, AI528662, gax, meox2, meox2b, mox-2, mox2, mox2b, mox, meox2a, MGC53386, MEOX2, btn, GB18266
Epitope
N-Term
(3), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Xenopus laevis, Human, Chicken
(48), (37), (37), (26), (26), (26), (26), (2), (1)
Host
Rabbit
(42), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(30), (20), (18), (9), (9), (1), (1)
Pubmed 2 references available
Catalog no. ABIN182641
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MEOX2
Sequence ATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGY PNEEGMFASQ
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against MEOX2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name MEOX2
Background MEOX2 is a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. MEOX2 may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.
Molecular Weight 33 kDa
Gene ID 4223
NCBI Accession NM_005924, NP_005915
UniProt Q6FHY5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 303 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Hosts (42), (6)
Reactivities (48), (37), (37), (26), (26), (26), (26), (2), (1)
Applications (30), (20), (18), (9), (9), (1), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (3), (2), (2), (2), (1), (1), (1), (1), (1)
back to top