Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182907

Kinesin Family Member 25 (KIF25) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KNSL3
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182907
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KIF25 antibody: synthetic peptide directed towards the C terminal of human KIF25
Sequence VLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCIS PSQRHLAQTL
Predicted Reactivity Human : 100%, Guinea pig : 85%, Horse : 78%
Characteristics This is a rabbit polyclonal antibody against KIF25. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name KIF25
Background The protein encoded by the KIF25 gene is a member of the kinesin-like protein family. Protein family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. However, the particular function of this gene product has not yet been determined. Two alternatively spliced transcript variants which encode products have been described. Other splice variants have been found that lack exon 2 and the initiation codon for translation.
Molecular Weight 41kDa
Gene ID 3834
NCBI Accession NP_085118, NM_030615
UniProt Q9UIL4
Research Area Signaling, Cytoskeleton
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KIF25 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Miki, Setou, Kaneshiro et al.: "All kinesin superfamily protein, KIF, genes in mouse and human." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 98, Issue 13, pp. 7004-11, 2001 (PubMed).

Alternatives for antigen "Kinesin Family Member 25 (KIF25)", type "Antibodies"
Hosts (9), (6)
Reactivities (13), (1)
Applications (15), (4), (3), (2), (1)
Epitopes (4), (2)
Beacon