Kinesin Family Member 25 (KIF25) (C-Term) antibody

Details for Product No. ABIN182907
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms KNSL3
Epitope
C-Term
(4), (2)
Reactivity
Dog (Canine), Human
(13), (1)
Host
Rabbit
(9), (6)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(15), (4), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN182907
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human KIF25
Sequence VLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCIS PSQRHLAQTL
Predicted Reactivity Human : 100 %, Guinea pig : 80 %, Horse : 70 %
Characteristics This is a rabbit polyclonal antibody against KIF25. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name KIF25
Background The protein encoded by the KIF25 gene is a member of the kinesin-like protein family. Protein family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. However, the particular function of this gene product has not yet been determined. Two alternatively spliced transcript variants which encode products have been described. Other splice variants have been found that lack exon 2 and the initiation codon for translation.
Molecular Weight 41 kDa
Gene ID 3834
NCBI Accession NM_030615, NP_085118
UniProt Q9UIL4
Research Area Signaling, Cytoskeleton
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 384 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Kinesin Family Member 25 (KIF25) (C-Term) antibody WB Suggested Anti-KIF25 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
anti-Kinesin Family Member 25 (KIF25) (C-Term) antibody (2) anti-Kinesin Family Member 25 (KIF25) (C-Term) antibody (Image 2)
Background publications Miki, Setou, Kaneshiro et al.: "All kinesin superfamily protein, KIF, genes in mouse and human." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 98, Issue 13, pp. 7004-11, 2001 (PubMed).

Hosts (9), (6)
Reactivities (13), (1)
Applications (15), (4), (3), (2)
Epitopes (4), (2)
back to top