Did you know that you can buy products from over 140 different suppliers from us?

Helicase-Like Transcription Factor (HLTF) (N-Term) antibody

Details for Product No. ABIN183023
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Snf2l3, Smarca3, RUSH, SMARCA3, ZBU1, HLTF1, RNF80, HIP116, SNF2L3, HIP116A, P113, AF010600, BC057116, smarca3, wu:fc33f07, HLTF, MGC131155
Epitope
N-Term
(5), (5), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(44), (16), (16), (15), (14), (12), (2)
Host
Rabbit
(37), (6), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(33), (10), (10), (10), (7), (3), (2), (1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183023
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SMARCA3
Sequence DPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDD FLTSDEEVDS
Predicted Reactivity Human :100 %,   Dog :90 %,   Bovine :90 %,   Mouse :90 %,   Rabbit :90 %,   Rat :80 %,  
Characteristics This is a rabbit polyclonal antibody against SMARCA3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name SMARCA3
Background SMARCA3 (HLTF) is a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. SMARCA3 contains a RING finger DNA binding motif. The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform which is truncated at the N-terminus as compared to the full-length protein.
Molecular Weight 114 kDa
Gene ID 6596
NCBI Accession NM_139048, NP_620636
UniProt Q14527
Research Area Cancer, Transcription Factors, Proteolysis / Ubiquitin
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1009 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Hosts (37), (6), (2)
Reactivities (44), (16), (16), (15), (14), (12), (2)
Applications (33), (10), (10), (10), (7), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (5), (1), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183023
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top