Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183078

Tripartite Motif Containing 39 (TRIM39) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RNF23, TFP, TRIM39B, 1100001D15Rik, E130103K13Rik, RBCC-B30.2, Rnf23, mKIAA4179, tfp, TRIM39.2, MGC78802, TRIM39, DKFZp459K1530
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183078
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRIM39 antibody: synthetic peptide directed towards the N terminal of human TRIM39
Sequence HTVVPLDDATQEYKEKLQKCLEPLEQKLQEITRCKSSEEK KPGELKRLVE
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Mouse : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against TRIM39. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name TRIM39
Background The protein encoded by TRIM39 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified. This gene lies within the major histocompatibility complex class I region on chromosome 6.
Molecular Weight 56kDa
Gene ID 56658
NCBI Accession NP_742013, NM_172016
UniProt Q5STG4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRIM39 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Reymond, Meroni, Fantozzi et al.: "The tripartite motif family identifies cell compartments." in: The EMBO journal, Vol. 20, Issue 9, pp. 2140-51, 2001 (PubMed).

Alternatives for antigen "Tripartite Motif Containing 39 (TRIM39)", type "Antibodies"
Hosts (24), (7), (5)
Reactivities (34), (18), (18), (15), (14), (5)
Applications (23), (12), (10), (6), (3), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon