Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2) antibody
| Antigen | Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2) |
| Synonyms | EAA4, GLR6, MRT6, GLUK6, GLUR6, MGC74427, Glur6, Glur-6, AW124492, Glurbeta2, GluR6, grik2-A, GRIK5, GRIK2, grik2 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB), Immunohistochemistry (IHC) |
 |
1 reference available |
| Catalog no. | ABIN183187 |
| Quantity | 100 µg (Variants) |
| Price | 251.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | Glutamate receptor 6 / GLUR6 |
| Gene ID | GRIK2 |
| UniProt | Q8IY40 |
| Immunogen | The immunogen for anti-GRIK2 antibody: synthetic peptide directed towards the N terminal of human GRIK2 |
| Sequence | PDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIK APSRYNLRLK |
| Cross-Reactivity | Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 100 µl of distilled water. Final anti-GRIK2 antibody concentration is 1 mg/ml. |
| Description | The GRIK2 gene encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus. The structure and function of the encoded protein is changed by RNA editing. |
| Characteristics | Antigen Size: 353 amino acids |
| Molecular Weight | 40kDa |
Application Details
| Application Notes |
WB Suggested Anti-GRIK2 Antibody Titration: 1.25ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate. |
| Purification | Protein A purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-GRIK2 Antibody Titration: 1.25ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate anti-Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2) antibody (Image 2) |
Publications
| Product |
Delorme, Krebs, Chabane et al.: "Frequency and transmission of glutamate receptors GRIK2 and GRIK3 polymorphisms in patients with obsessive compulsive disorder." in: Neuroreport, Vol. 15, Issue 4, pp. 699-702, 2004 (PubMed).
|
Alternatives
Alternatives for antigen "Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2)", type "Antibodies"
| Hosts | Rabbit (44) |
| Reactivities | Human (40), Mouse (Murine) (32), Rat (Rattus) (31), Chicken (4), Cow (Bovine) (3), Dog (Canine) (3), Monkey (3), Xenopus laevis (2), Cat (Feline) (1), Zebrafish (1) |
| Applications | Western Blotting (WB) (29), ELISA (16), Immunofluorescence (IF) (16), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (8), Immunohistochemistry (IHC) (6), Immunoprecipitation (IP) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1) |
| Conjugates | Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1) |
| Epitopes | C-Term (3), N-Term (2), 1st Extracellular Domain (1) |
Sponsorship
2013 BioMed Central Research Awards
2013 BioMed Central Research Awards
