Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183331

DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 (DDX5) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms G17P1, HLR1, HUMP68, p68, 2600009A06Rik, Hlr1, wu:fa56a07, wu:fb11e01, wu:fb16c10, wu:fb53b05
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183331
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DDX5 antibody: synthetic peptide directed towards the C terminal of human DDX5
Sequence SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPN MHNGMNQQAY
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Chicken : 83%
Characteristics This is a rabbit polyclonal antibody against DDX5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name DDX5
Background DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX5 encodes a DEAD box protein, which is a RNA-dependent ATPase, and also a proliferation-associated nuclear antigen, specifically reacting with the simian virus 40 tumor antigen. DDX5 consists of 13 exons, and alternatively spliced transcripts containing several intron sequences have been detected, but no isoforms encoded by these transcripts have been identified.
Molecular Weight 68kDa
Gene ID 1655
NCBI Accession NP_004387, NM_004396
UniProt P17844
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DDX5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Guil, Gattoni, Carrascal et al.: "Roles of hnRNP A1, SR proteins, and p68 helicase in c-H-ras alternative splicing regulation." in: Molecular and cellular biology, Vol. 23, Issue 8, pp. 2927-41, 2003 (PubMed).

Alternatives for antigen "DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 (DDX5)", type "Antibodies"
Hosts (60), (11), (6)
Reactivities (74), (44), (43), (25), (13), (5)
Applications (47), (30), (20), (16), (14), (13), (8), (7), (3), (2), (2)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (17), (15), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Beacon