SATB Homeobox 1 (SATB1) (C-Term) antibody

Details for Product No. ABIN183628
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms AW413156, 2610306G12Rik, SATB1
Epitope
C-Term
(15), (12), (9), (7), (5), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Human, Chicken
(72), (38), (25), (13), (13), (13), (12)
Host
Rabbit
(51), (17), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(61), (35), (22), (19), (10), (10), (6), (4), (2), (2), (1), (1)
Pubmed 2 references available
Catalog no. ABIN183628
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human SATB1
Sequence VDVAEYKEEELLKDLEESVQDKNTNTLFSVKLEEELSVEG NTDINTDLKD
Predicted Reactivity Human : 100 %, Dog : 90 %, Guinea pig : 80 %, Rabbit : 80 %, Rat : 80 %, Pig : 80 %, Chicken : 70 %, Mouse : 70 %
Characteristics This is a rabbit polyclonal antibody against SATB1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name SATB1
Background SATB1 binds to DNA at special AT-rich sequences at nuclear matrix- or scaffold-associated regions. SATB1 was thought to recognize the sugar-phosphate structure of double-stranded DNA
Molecular Weight 86 kDa
Gene ID 6304
NCBI Accession NM_002971, NP_002962
UniProt Q01826
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 763 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-SATB Homeobox 1 (SATB1) (C-Term) antibody WB Suggested Anti-SATB1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Product cited in: Green, Roeder: "Definition of a novel promoter for the major adenovirus-associated virus mRNA." in: Cell, Vol. 22, Issue 1 Pt 1, pp. 231-42, 1981 (PubMed).

Background publications Pavan Kumar, Purbey, Sinha et al.: "Phosphorylation of SATB1, a global gene regulator, acts as a molecular switch regulating its transcriptional activity in vivo." in: Molecular cell, Vol. 22, Issue 2, pp. 231-43, 2006 (PubMed).

Hosts (51), (17), (4)
Reactivities (72), (38), (25), (13), (13), (13), (12)
Applications (61), (35), (22), (19), (10), (10), (6), (4), (2), (2), (1), (1)
Conjugates (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (15), (12), (9), (7), (5), (1), (1)
back to top