Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183630

Helicase-Like Transcription Factor (HLTF) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Snf2l3, Smarca3, RUSH, SMARCA3, ZBU1, HLTF1, RNF80, HIP116, SNF2L3, HIP116A, P113, AF010600, BC057116, smarca3, wu:fc33f07, HLTF, MGC131155
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rabbit, Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183630
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SMARCA3 antibody: synthetic peptide directed towards the C terminal of human SMARCA3
Sequence FIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAK INEIRTLIDL
Predicted Reactivity Human :100%,   Rat :85%,   Dog :85%,   Rabbit :85%,  
Characteristics This is a rabbit polyclonal antibody against SMARCA3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name SMARCA3
Background SMARCA3 (HLTF) is a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. SMARCA3 contains a RING finger DNA binding motif. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform which is truncated at the N-terminus as compared to the full-length protein.
Molecular Weight 114kDa
Gene ID 6596
NCBI Accession NP_620636, NM_139048
UniProt Q14527
Research Area Cancer, Transcription Factors, Proteolysis / Ubiquitin
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SMARCA3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Alternatives for antigen "Helicase-Like Transcription Factor (HLTF)", type "Antibodies"
Hosts (41), (7), (1)
Reactivities (47), (17), (16), (15), (15), (12), (2)
Applications (37), (12), (10), (9), (3), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (4), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon