Did you know that you can buy products from over 140 different suppliers from us?

Ring Finger Protein 14 (RNF14) (C-Term) antibody

Details for Product No. ABIN183658
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARA54, HFB30, TRIAD2, 2310075C09Rik, 2610005D23Rik, AA986456, AU041447, D18Ertd188e, D7Bwg0165e, Triad2
Epitope
C-Term
(9), (7), (4), (2), (2), (2), (1), (1), (1)
Reactivity
Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(54), (36), (32), (24), (24), (24)
Host
Rabbit
(52), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(38), (20), (19), (6), (2), (2), (1), (1)
Pubmed 2 references available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183658
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human RNF14
Sequence CMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVD DDIWEDEVED
Predicted Reactivity Human : 100 %, Bovine : 70 %, Dog : 70 %, Rabbit : 70 %, Rat : 70 %
Characteristics This is a rabbit polyclonal antibody against RNF14. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name RNF14
Background RNF14 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins.The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Five alternatively spliced transcript variants encoding two distinct isoforms have been reported.
Molecular Weight 52 kDa
Gene ID 9604
NCBI Accession NM_183401, NP_899648
UniProt Q9UBS8
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Proteolysis / Ubiquitin
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 474 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ring Finger Protein 14 (RNF14) (C-Term) antibody WB Suggested Anti-RNF14 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
anti-Ring Finger Protein 14 (RNF14) (C-Term) antibody (2) anti-Ring Finger Protein 14 (RNF14) (C-Term) antibody (Image 2)
Product cited in: Lin, Wu, Tarr et al.: "Defects in adaptive energy metabolism with CNS-linked hyperactivity in PGC-1alpha null mice." in: Cell, Vol. 119, Issue 1, pp. 121-35, 2004 (PubMed).

Background publications Lin, Fang, Ma et al.: "Negative modulation of androgen receptor transcriptional activity by Daxx." in: Molecular and cellular biology, Vol. 24, Issue 24, pp. 10529-41, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183658
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top