Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183682

Tumor Protein P73 (TP73) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms P73, TAp73, zp73theta, TP73, tp73
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183682
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TP73 antibody: synthetic peptide directed towards the N terminal of human TP73
Sequence MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNE VVGGTDSSMD
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against TP73. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name TP73
Background TP73 belongs to the p53 family. It participates in the apoptotic response to DNA damage. When overproduced, it activates transcription from p53-responsive promoters and induces apoptosis. TP53 may be a tumor suppressor protein.
Molecular Weight 55kDa
Gene ID 7161
NCBI Accession CAA72219, NM_001126240
UniProt O15350-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TP73 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kaghad, Bonnet, Yang et al.: "Monoallelically expressed gene related to p53 at 1p36, a region frequently deleted in neuroblastoma and other human cancers." in: Cell, Vol. 90, Issue 4, pp. 809-19, 1997 (PubMed).

Alternatives for antigen "Tumor Protein P73 (TP73)", type "Antibodies"
Hosts (71), (33)
Reactivities (97), (39), (26), (8), (2)
Applications (92), (32), (28), (24), (12), (10), (9), (8), (8), (5), (4), (3), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (12), (9), (7), (5), (5), (3), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Beacon