Tumor Protein P73 (TP73) (N-Term) antibody

Details for Product No. ABIN183682
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms P73, TAp73, zp73theta, TP73, tp73
Epitope
N-Term
(11), (9), (6), (4), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Human
(90), (34), (25), (8), (2)
Host
Rabbit
(68), (29)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(86), (28), (26), (20), (13), (10), (9), (8), (5), (3), (3), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183682
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TP73
Sequence MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNE VVGGTDSSMD
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against TP73. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name TP73
Background TP73 belongs to the p53 family. It participates in the apoptotic response to DNA damage. When overproduced, it activates transcription from p53-responsive promoters and induces apoptosis. TP53 may be a tumor suppressor protein.
Molecular Weight 55 kDa
Gene ID 7161
NCBI Accession NM_001126240
UniProt O15350-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 499 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tumor Protein P73 (TP73) (N-Term) antibody WB Suggested Anti-TP73 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
Background publications Kaghad, Bonnet, Yang et al.: "Monoallelically expressed gene related to p53 at 1p36, a region frequently deleted in neuroblastoma and other human cancers." in: Cell, Vol. 90, Issue 4, pp. 809-19, 1997 (PubMed).

Hosts (68), (29)
Reactivities (90), (34), (25), (8), (2)
Applications (86), (28), (26), (20), (13), (10), (9), (8), (5), (3), (3), (2), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (11), (9), (6), (4), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
back to top