Did you know that you can buy products from over 140 different suppliers from us?

Nuclear Factor (erythroid-Derived 2)-Like 2 (NFE2L2) (C-Term) antibody

Details for Product No. ABIN183702
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NRF2, Nrf2, AI194320, NF-E2R2, nfe2l2, wu:fc15g09, wu:fj67e03
Epitope
C-Term
(16), (13), (9), (7), (5), (4), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
(107), (53), (49), (25), (25), (24), (1)
Host
Rabbit
(89), (19), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(77), (51), (27), (22), (20), (19), (16), (4), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN183702
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human NFE2L2
Sequence KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSE YSLQQTRDGN
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Pig : 100 %, Rat : 100 %, Bovine : 90 %, Chicken : 90 %, Horse : 90 %, Rabbit : 90 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against NFE2L2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name NFE2L2
Background NFE2 (MIM 601490), NFE2L1 (MIM 163260), and NFE2L2 comprise a family of human genes encoding basic leucine zipper (bZIP) transcription factors. They share highly conserved regions that are distinct from other bZIP families, such as JUN (MIM 165160) and FOS (MIM 164810), although remaining regions have diverged considerably from each other. NFE2L2 may be involved in the transcriptional activation of genes of the beta-globin cluster by mediating enhancer activity of hypersensitive site 2 of the beta-globin locus control region.NFE2 (MIM 601490), NFE2L1 (MIM 163260), and NFE2L2 comprise a family of human genes encoding basic leucine zipper (bZIP) transcription factors. They share highly conserved regions that are distinct from other bZIP families, such as JUN (MIM 165160) and FOS (MIM 164810), although remaining regions have diverged considerably from each other (Chan et al., 1995).
Molecular Weight 68 kDa
Gene ID 4780
NCBI Accession NM_006164, NP_006155
UniProt Q16236
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 605 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Nuclear Factor (erythroid-Derived 2)-Like 2 (NFE2L2) (C-Term) antibody WB Suggested Anti-NFE2L2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: A172 cell lysate
Background publications Padmanabhan, Tong, Ohta et al.: "Structural basis for defects of Keap1 activity provoked by its point mutations in lung cancer." in: Molecular cell, Vol. 21, Issue 5, pp. 689-700, 2006 (PubMed).

Hosts (89), (19), (3)
Reactivities (107), (53), (49), (25), (25), (24), (1)
Applications (77), (51), (27), (22), (20), (19), (16), (4), (2), (1)
Conjugates (4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (16), (13), (9), (7), (5), (4), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top