Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183702

Nuclear Factor (erythroid-Derived 2)-Like 2 (NFE2L2) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NRF2, Nrf2, AI194320, NF-E2R2, nfe2l2, wu:fc15g09, wu:fj67e03
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183702
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NFE2L2 antibody: synthetic peptide directed towards the C terminal of human NFE2L2
Sequence KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSE YSLQQTRDGN
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Human : 100%, Pig : 100%, Rat : 100%, Bovine : 92%, Chicken : 92%, Horse : 92%, Rabbit : 92%, African clawed frog : 84%
Characteristics This is a rabbit polyclonal antibody against NFE2L2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name NFE2L2
Background NFE2 (MIM 601490), NFE2L1 (MIM 163260), and NFE2L2 comprise a family of human genes encoding basic leucine zipper (bZIP) transcription factors. They share highly conserved regions that are distinct from other bZIP families, such as JUN (MIM 165160) and FOS (MIM 164810), although remaining regions have diverged considerably from each other. NFE2L2 may be involved in the transcriptional activation of genes of the beta-globin cluster by mediating enhancer activity of hypersensitive site 2 of the beta-globin locus control region.NFE2 (MIM 601490), NFE2L1 (MIM 163260), and NFE2L2 comprise a family of human genes encoding basic leucine zipper (bZIP) transcription factors. They share highly conserved regions that are distinct from other bZIP families, such as JUN (MIM 165160) and FOS (MIM 164810), although remaining regions have diverged considerably from each other (Chan et al., 1995).
Molecular Weight 68kDa
Gene ID 4780
NCBI Accession NP_006155, NM_006164
UniProt Q16236
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NFE2L2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Padmanabhan, Tong, Ohta et al.: "Structural basis for defects of Keap1 activity provoked by its point mutations in lung cancer." in: Molecular cell, Vol. 21, Issue 5, pp. 689-700, 2006 (PubMed).

Alternatives for antigen "Nuclear Factor (erythroid-Derived 2)-Like 2 (NFE2L2)", type "Antibodies"
Hosts (72), (16), (3)
Reactivities (89), (47), (44), (25), (25), (24), (1)
Applications (55), (34), (27), (20), (16), (14), (11), (4), (2), (2)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (13), (11), (5), (5), (4), (4), (3), (3), (2), (2), (2), (1), (1)
Beacon