Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Apoptosis Antagonizing Transcription Factor (AATF) antibody

Antigen

Apoptosis Antagonizing Transcription Factor (AATF)

Synonyms DED, CHE1, CHE-1, Trb, Che-1, MGC35916, 4933415H02Rik, 5830465M17Rik, Ded, AATF, ded, che1, che-1, cb109, sb:cb109, wu:fc13d05, zgc:162071
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183738
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name AATF
Gene ID AATF
UniProt Q9NY61
Immunogen The immunogen for anti-AATF antibody: synthetic peptide directed towards the C terminal of human AATF
Sequence PNDQVAMGRQWLAIQKLRSKIHKKVDRKASKGRKLRFHVL SKLLSFMAPI
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-AATF antibody concentration is 1 mg/ml.
Description The AATF gene encodes a protein that was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.
Characteristics Antigen Size: 560 amino acids
Molecular Weight 63kDa

Application Details

Application Notes WB Suggested Anti-AATF Antibody Titration: 0.25ug/ml
ELISA Titer: 1:312500
Positive Control: Human kidney.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Alternatives

Alternatives for antigen "Apoptosis Antagonizing Transcription Factor (AATF)", type "Antibodies"
Hosts Rabbit (44), Mouse (7)
Reactivities Human (50), Mouse (Murine) (29), Rat (Rattus) (25), Cow (Bovine) (20), Guinea Pig (18), Horse (Equine) (18), Pig (Porcine) (18), Dog (Canine) (3), Chicken (2), Cat (Feline) (1)
Applications Western Blotting (WB) (31), ELISA (21), Immunofluorescence (IF) (20), Immunohistochemistry (IHC) (10), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (9), Immunoprecipitation (IP) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Dot Blot (Dot) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Biotin (2), FITC (2), HRP (2), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), Gold (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (5), N-Term (4), AA 125-175 (1), AA 151-250 (1)