Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183849

High Mobility Group Box 4 (HMGB4) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1700001F22Rik, AI326135, dJ1007G16.5, HMGB4
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN183849
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HMGB4 antibody: synthetic peptide directed towards the C terminal of human HMGB4
Sequence WSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKY RMSARNRCRG
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against HMGB4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HMGB4
Background HMGB4 contains two HMG-box regions, which is found in a variety of eukaryotic chromosomal proteins and transcription.
Molecular Weight 22kDa
Gene ID 127540
NCBI Accession NP_660206, NM_145205
UniProt Q8WW32
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HMGB4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Alternatives for antigen "High Mobility Group Box 4 (HMGB4)", type "Antibodies"
Hosts (42)
Reactivities (42), (22), (22), (13), (12), (12)
Applications (28), (10), (7), (5), (4), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (2), (1), (1), (1), (1), (1)
Beacon