Cysteinyl-tRNA Synthetase (CARS) (C-Term) antibody

Details for Product No. ABIN183921
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms
CARS1, CYSRS, MGC:11246, CA3, sb:cb71, CARS, BcDNA:LD21177, CG8431, CRS, CysRS, Dmel\\CG8431, BA0089, DDBDRAFT_0215191, DDBDRAFT_0231320, DDB_0215191, DDB_0231320, DDBDRAFT_0187313, DDBDRAFT_0231318,  ... show more
CARS1, CYSRS, MGC:11246, CA3, sb:cb71, CARS, BcDNA:LD21177, CG8431, CRS, CysRS, Dmel\\CG8431, BA0089, DDBDRAFT_0215191, DDBDRAFT_0231320, DDB_0215191, DDB_0231320, DDBDRAFT_0187313, DDBDRAFT_0231318, DDB_0187313, DDB_0231318, T16B12.16, K15E6.3, K15E6_3 show less
Epitope
C-Term
(5), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Human, Chicken
(11), (3), (3), (1), (1), (1), (1)
Host
Rabbit
(15)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(14), (7), (2), (2), (1)
Pubmed 2 references available
Catalog no. ABIN183921
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human CARS
Sequence KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSK FDENGLPTHD
Predicted Reactivity Human : 100 %, Rabbit : 100 %, Chicken : 90 %, Dog : 90 %, Mouse : 90 %, Rat : 90 %, Zebrafish : 90 %, Pig : 80 %, Bovine : 70 %
Characteristics This is a rabbit polyclonal antibody against CARS. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name CARS
Background CARS is a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.
Molecular Weight 81 kDa
Gene ID 833
NCBI Accession NM_001014438, NP_001014438
Research Area Chromatin and Nuclear Signaling, DNA/RNA, Metabolism, Amino Acids
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 738 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Cysteinyl-tRNA Synthetase (CARS) (C-Term) antibody WB Suggested Anti-CARS Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
anti-Cysteinyl-tRNA Synthetase (CARS) (C-Term) antibody (2) anti-Cysteinyl-tRNA Synthetase (CARS) (C-Term) antibody (Image 2)
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Hosts (15)
Reactivities (11), (3), (3), (1), (1), (1), (1)
Applications (14), (7), (2), (2), (1)
Epitopes (5), (2), (1), (1)
back to top