Did you know that you can buy products from over 140 different suppliers from us?

Ribosomal Protein S14 (RPS14) (Middle Region) antibody

Details for Product No. ABIN183929
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EMTB, S14, 2600014J02Rik, AL023078, fa92e08, wu:fa92e08, zgc:73215
Epitope
Middle Region
(6), (5), (4), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Zebrafish (Danio rerio)
(31), (4), (4), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(27), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1)
Application
Western Blotting (WB)
(31), (21), (12), (4), (1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183929
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RPS14
Sequence GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTR RKGGRRGRRL
Predicted Reactivity African clawed frog : 100 %, Chicken : 100 %, Dog : 100 %, Mouse : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against RPS14. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name RPS14
Background Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS14 is a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. In Chinese hamster ovary cells, mutations in this gene can lead to resistance to emetine, a protein synthesis inhibitor.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. In Chinese hamster ovary cells, mutations in this gene can lead to resistance to emetine, a protein synthesis inhibitor. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Molecular Weight 17 kDa
Gene ID 6208
NCBI Accession NM_001025071, NP_001020242
UniProt P62263
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 151 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ribosomal Protein S14 (RPS14) (Middle Region) antibody WB Suggested Anti-RPS14 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
Background publications Kenmochi, Kawaguchi, Rozen et al.: "A map of 75 human ribosomal protein genes." in: Genome research, Vol. 8, Issue 5, pp. 509-23, 1998 (PubMed).

Hosts (27), (7)
Reactivities (31), (4), (4), (1), (1), (1), (1), (1), (1)
Applications (31), (21), (12), (4), (1), (1)
Conjugates (2), (2), (2), (1), (1), (1)
Epitopes (6), (5), (4), (2), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183929
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top