Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184065

DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms P72, RH70, 2610007K22Rik, A430025E01Rik, AI047725, C80929, Gm926, p72, Cp68, DDX46, MGC80019, DDX17
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184065
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DDX17 antibody: synthetic peptide directed towards the N terminal of human DDX17
Sequence TSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETD RAGYANGSGY
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Human : 100%, Bovine : 92%, Horse : 92%, Mouse : 92%, Pig : 92%, Rabbit : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against DDX17. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name DDX17
Background DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The DEAD box protein is an ATPase activated by a variety of RNA species but not by dsDNA. This protein and that encoded by DDX5 gene are more closely related to each other than to any other member of the DEAD box family.
Molecular Weight 60kDa
Gene ID 10521
NCBI Accession EAW60248, NM_001098504
UniProt Q92841
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DDX17 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Venter, Adams, Myers et al.: "The sequence of the human genome." in: Science (New York, N.Y.), Vol. 291, Issue 5507, pp. 1304-51, 2001 (PubMed).

Alternatives for antigen "DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17)", type "Antibodies"
Hosts (14), (4)
Reactivities (16), (4), (3), (1), (1), (1)
Applications (17), (6), (4), (4), (4), (2), (2), (2), (1)
Epitopes (7), (2), (2), (1)
Beacon