Did you know that you can buy products from over 140 different suppliers from us?

DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) (N-Term) antibody

Details for Product No. ABIN184065
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MGC80019, DDX17, P72, RH70, Cp68, DDX46, 2610007K22Rik, A430025E01Rik, AI047725, C80929, Gm926, p72
Epitope
N-Term
(12), (8), (3), (2), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(24), (4), (3), (1), (1), (1)
Host
Rabbit
(22), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(24), (12), (10), (10), (5), (5), (2), (2), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN184065
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DDX17
Sequence TSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETD RAGYANGSGY
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Bovine : 90 %, Horse : 90 %, Mouse : 90 %, Pig : 90 %, Rabbit : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against DDX17. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name DDX17
Background DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The DEAD box protein is an ATPase activated by a variety of RNA species but not by dsDNA. This protein and that encoded by DDX5 gene are more closely related to each other than to any other member of the DEAD box family.
Molecular Weight 60 kDa
Gene ID 10521
NCBI Accession NM_001098504
UniProt Q92841
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 547 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) (N-Term) antibody WB Suggested Anti-DDX17 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) (N-Term) antibody (2) anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) (N-Term) antibody (Image 2)
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) (N-Term) antibody (3) Rabbit Anti-DDX17 Antibody ,Paraffin Embedded Tissue: Human alveolar cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 µg/mL
Magnification:.00X
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) (N-Term) antibody (4) WB Suggested Anti-DDX17
Antibody Titration: 1.25 µg/mL
Positive Control: Jurkat cell lysate
DDX17 is supported by BioGPS gene expression data to be expressed in Jurkat
Background publications Venter, Adams, Myers et al.: "The sequence of the human genome." in: Science (New York, N.Y.), Vol. 291, Issue 5507, pp. 1304-51, 2001 (PubMed).

Validation Images
back to top