Catenin (Cadherin-Associated Protein), beta 1, 88kDa (CTNNB1) (C-Term) antibody

Details for Product No. ABIN184258
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CTNNB, MRD19, armadillo, ctnnb1, Jup, LOC100217813, CTNNB1
Epitope
C-Term
(51), (21), (20), (20), (16), (15), (9), (8), (7), (6), (6), (6), (5), (5), (5), (4), (4), (4), (4), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Pig (Porcine), Cow (Bovine), Human, Zebrafish (Danio rerio), Chicken
(364), (117), (97), (14), (12), (10), (4), (4), (3), (3), (3), (3), (1)
Host
Rabbit
(266), (131), (2), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(5), (2), (2), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(366), (128), (106), (91), (81), (67), (57), (39), (26), (8), (3), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN184258
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human CTNNB1
Sequence DPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDS NQLAWFDTDL
Predicted Reactivity African clawed frog : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against CTNNB1. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name CTNNB1
Background CTNNB1 is involved in the regulation of cell adhesion and in signal transduction through the Wnt pathway.
Molecular Weight 76 kDa
Gene ID 1499
NCBI Accession XP_001133664
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 694 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Catenin (Cadherin-Associated Protein), beta 1, 88kDa (CTNNB1) (C-Term) antibody WB Suggested Anti-CTNNB1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Onilude, Lusher, Lindsey et al.: "APC and CTNNB1 mutations are rare in sporadic ependymomas." in: Cancer genetics and cytogenetics, Vol. 168, Issue 2, pp. 158-61, 2006 (PubMed).

Hosts (266), (131), (2), (1)
Reactivities (364), (117), (97), (14), (12), (10), (4), (4), (3), (3), (3), (3), (1)
Applications (366), (128), (106), (91), (81), (67), (57), (39), (26), (8), (3), (2), (2), (1), (1)
Conjugates (5), (2), (2), (1), (1), (1)
Epitopes (51), (21), (20), (20), (16), (15), (9), (8), (7), (6), (6), (6), (5), (5), (5), (4), (4), (4), (4), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top