TLR5 antibody

Catalog No. ABIN187770

Product Details anti-TLR5 Antibody

Target: TLR5 (Toll-Like Receptor 5 (TLR5))

Reactivity: Human

Host: Goat

Clonality: Polyclonal

Conjugate: This TLR5 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF)

Specificity: Recognizes human Toll-like receptor 5 (TLR5). Peptide sequence is >50% identical to other human TLRs in this region. Species Reactivity: Human. Other species not tested.

Immunogen: Synthetic peptide corresponding to aa 151-181 (D151LSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ181) of human TLR5.

Application Details

Application Notes: Flow Cytometry Immunocytochemistry: 1:500 Immunohistochemistry: Paraffin sections 1:250 Western blot The optimal dilution for a specific application should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: Liquid. 100 µg of peptide affinity purified antibody in PBS at 2 mg/ml, containing 1 mg/ml BSA and 0.1% sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C

Target Details for TLR5

Target: TLR5 (Toll-Like Receptor 5 (TLR5))

Alternative Name: TLR5 (TLR5 Products)

Synonyms: SLEB1 antibody, TIL3 antibody, TLR-5 antibody, sleb1 antibody, til3 antibody, tlr-5 antibody, tlr5 antibody, toll like receptor 5 antibody, toll-like receptor 5 antibody, toll like receptor 5 L homeolog antibody, toll-like receptor 5b antibody, TLR5 antibody, Tlr5 antibody, tlr5.L antibody, tlr-5 antibody, tlr5b antibody

Pathways: TLR Signaling, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades