You are viewing an incomplete version of our website. Please click to reload the website as full version.

Defensin, beta 4A (DEFB4) (AA 4-41) antibody

Details for Product No. ABIN191996, Supplier: Log in to see
  • BD-2
  • BD2
  • BNBD-2
  • BNDB-2
  • DEFB-2
  • DEFB2
  • DEFB4
  • DEFB4P
  • DEFB102
  • DEFB104
  • DEFB104B
  • HBD-2
  • SAP1
  • THP2
AA 4-41
Clonality (Clone)
Monoclonal ()
Enzyme Immunoassay (EIA), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Immunogen Synthetic peptide corresponding to amino acids 4-41 of Human beta-Defensin 2. AA Sequence: DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Clone L12-4C-C2
Isotype IgG1
Specificity This antibody recognizes Human beta-Defensin 2 (aa 4-41).
Characteristics Synonyms: Beta-defensin 4A, Beta-defensin 2, BD-2, hBD-2, DEFB102, DEFB2, Skin-antimicrobialpeptide 1, DEFB4B, DEFB4A
Purification Protein G Chromatography
Alternative Name Defensin beta 2 (DEFB4 Antibody Abstract)
Background This antibiotic peptide is locally regulated by inflammation. Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence.Synonyms: BD-2, Beta-defensin 2, Beta-defensin 4A, DEFB102, DEFB2, DEFB4A, DEFB4B, Skin-antimicrobial peptide 1, hBD-2
Gene ID 100289462
UniProt O15263
Research Area Immunology
Application Notes ELISA.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.
Restrictions For Research Use only
Reconstitution Restore in 0.1 mL aqua bidest to 1 mg/mL.
Buffer 50 mM TRIS pH 7.4
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8 °C and reconstituted at -20 °C. Avoid repeated freezing and thawing.
Shelf life: One year from despatch.
Expiry Date 12 months
Supplier Images
Immunohistochemistry (IHC) image for anti-Defensin, beta 4A (DEFB4) (AA 4-41) antibody (ABIN191996) anti-Defensin, beta 4A (DEFB4) (AA 4-41) antibody
Background publications Langhorst, Junge, Rueffer, Wehkamp, Foell, Michalsen, Musial, Dobos: "Elevated human beta-defensin-2 levels indicate an activation of the innate immune system in patients with irritable bowel syndrome." in: The American journal of gastroenterology, Vol. 104, Issue 2, pp. 404-10, 2009 (PubMed).