Defensin, beta 4A (DEFB4) (AA 4-41) antibody

Details for Product No. ABIN191997, Supplier: Login to see New
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Synonyms THP2, DEFB104, DEFB104B, DEFB4, DEFB102, BD-2, BD2, DEFB2, DEFB-2, HBD-2, SAP1, DEFB4P, BNBD-2, BNDB-2
AA 4-41
(18), (13), (8), (5), (5), (4), (3), (1), (1), (1), (1)
(84), (23), (19)
(67), (34), (12), (11)
Clonality (Clone)
Monoclonal ()
(17), (5), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Enzyme Immunoassay (EIA), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(76), (71), (22), (15), (10), (9), (7), (6), (2), (1), (1), (1)
Pubmed 1 reference available
Supplier Login to see New
Supplier Product Number Login to see New
Quantity 0.1 mg
Shipping to United States ( )
Availability Will be delivered in 6 to 8 Business Days
Immunogen Synthetic peptide corresponding to amino acids 4-41 of Human beta-Defensin 2. AA Sequence: DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Clone L12-4C-C2
Isotype IgG1
Specificity This antibody recognizes Human beta-Defensin 2 (aa 4-41).
Characteristics Synonyms: Beta-defensin 4A, Beta-defensin 2, BD-2, hBD-2, DEFB102, DEFB2, Skin-antimicrobialpeptide 1, DEFB4B, DEFB4A
Purification Protein G Chromatography
Alternative Name Defensin beta 2 (DEFB4 Antibody Abstract)
Background This antibiotic peptide is locally regulated by inflammation. Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence.Synonyms: BD-2, Beta-defensin 2, Beta-defensin 4A, DEFB102, DEFB2, DEFB4A, DEFB4B, Skin-antimicrobial peptide 1, hBD-2
Gene ID 100289462
UniProt O15263
Research Area Immunology
Application Notes ELISA.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.
Restrictions For Research Use only
Reconstitution Restore in 0.1 mL aqua bidest to 1 mg/mL.
Buffer 50 mM TRIS pH 7.4
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8 °C and reconstituted at -20 °C. Avoid repeated freezing and thawing.
Shelf life: One year from despatch.
Expiry Date 12 months
Supplier Images
Immunohistochemistry (IHC) image for anti-Defensin, beta 4A (DEFB4) (AA 4-41) antibody (ABIN191997) anti-Defensin, beta 4A (DEFB4) (AA 4-41) antibody
Background publications Langhorst, Junge, Rueffer et al.: "Elevated human beta-defensin-2 levels indicate an activation of the innate immune system in patients with irritable bowel syndrome." in: The American journal of gastroenterology, Vol. 104, Issue 2, pp. 404-10, 2009 (PubMed).

Catalog No. ABIN191997
Plus shipping costs $45.00

Order hotline:

  • +1 877 302 8632
  • +1 888 205 9894 (TF)
Did you look for something else?