Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

ERK1 antibody (AA 372-406)

The Rabbit Polyclonal anti-ERK1 antibody is suitable to detect ERK1 in samples from Mouse, Rat, Rabbit and Hamster. It has been validated for WB, IP and Func.
Catalog No. ABIN199418
-15% Promotion 2026
$854.59
$1,005.40
save $150.81 (-15 %)
Plus shipping costs $50.00
100 μg
Shipping to: United States
Delivery in 11 to 14 Business Days

Quick Overview for ERK1 antibody (AA 372-406) (ABIN199418)

Target

See all ERK1 (MAPK3) Antibodies
ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Reactivity

  • 246
  • 179
  • 139
  • 43
  • 20
  • 18
  • 16
  • 11
  • 9
  • 9
  • 9
  • 7
  • 7
  • 7
  • 5
  • 3
  • 3
  • 3
  • 2
  • 1
  • 1
  • 1
  • 1
Mouse, Rat, Rabbit, Hamster

Host

  • 253
  • 27
  • 3
  • 1
  • 1
Rabbit

Clonality

  • 199
  • 86
Polyclonal

Conjugate

  • 123
  • 18
  • 15
  • 13
  • 7
  • 6
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 3
  • 3
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
This ERK1 antibody is un-conjugated

Application

  • 240
  • 104
  • 82
  • 71
  • 71
  • 67
  • 65
  • 54
  • 42
  • 33
  • 18
  • 11
  • 7
  • 5
  • 3
  • 2
  • 1
Western Blotting (WB), Immunoprecipitation (IP), Functional Studies (Func)
  • Binding Specificity

    • 73
    • 59
    • 30
    • 24
    • 16
    • 15
    • 15
    • 11
    • 9
    • 9
    • 8
    • 7
    • 6
    • 5
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 372-406

    Specificity

    Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species cross-reactivity: Human, mouse, chicken and starfish. Species sequence Homology: Chinese hamster: 35/35, mouse: 34/35, human: 32/35.

    Predicted Reactivity

    Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).

    Purification

    Immunoaffinity purified

    Immunogen

    Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled). Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).

    Type of Immunogen: Synthetic peptide - KLH conjugated

    Isotype

    IgG
  • Application Notes

    Approved: Func, IP, WB (0.1 - 2 μg/mL)

    Usage: Suitable for use in Western Blot and Immunoprecipitation. Western Blot: 0.1-2 μg/mL detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells. 3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1 μg/mL). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunoprecipitation Kinase Assay: 4 μg immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50 ng/mL) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit.

    Comment

    Target Species of Antibody: Rat

    Restrictions

    For Research Use only
  • Format

    Liquid

    Concentration

    Lot specific

    Buffer

    0.2 M Tris-glycine,  pH 7.4, 0.15 M sodium chloride, 0.05 % sodium azide, 0.1 mM EDTA.

    Preservative

    Sodium azide

    Precaution of Use

    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

    Handling Advice

    Avoid repeat freeze-thaw cycles.

    Storage

    4 °C,-20 °C

    Storage Comment

    Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
  • Target

    ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

    Alternative Name

    MAPK3 / ERK1

    Background

    Name/Gene ID: MAPK3
    Subfamily: MAPK
    Family: Protein Kinase

    Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3

    Gene ID

    5595

    UniProt

    P27361

    Pathways

    MAPK Signaling, RTK Signaling, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteins
You are here:
Chat with us!