Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Cytokeratin 19 antibody (C-Term)

KRT19 Reactivity: Human, Mouse, Rat WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN3043288
  • Target See all Cytokeratin 19 (KRT19) Antibodies
    Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))
    Binding Specificity
    • 19
    • 16
    • 16
    • 10
    • 8
    • 6
    • 6
    • 5
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 334-372, C-Term
    Reactivity
    • 254
    • 89
    • 71
    • 7
    • 7
    • 6
    • 5
    • 5
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 135
    • 129
    • 3
    • 1
    • 1
    Rabbit
    Clonality
    • 139
    • 130
    Polyclonal
    Conjugate
    • 118
    • 33
    • 19
    • 13
    • 7
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    This Cytokeratin 19 antibody is un-conjugated
    Application
    • 185
    • 93
    • 83
    • 81
    • 66
    • 43
    • 40
    • 39
    • 33
    • 29
    • 21
    • 21
    • 7
    • 6
    • 6
    • 5
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit IgG polyclonal antibody for Keratin, type I cytoskeletal 19(KRT19) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequence
    QLAHIQALIS GIEAQLGDVR ADSERQNQEY QRLMDIKSR
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for Keratin, type I cytoskeletal 19(KRT19) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: keratin 19
    Protein Name: Keratin, type I cytoskeletal 19
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product KRT19 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Quan, Du, Hou, Wang, Zhang: "Utilization of E-cadherin by monocytes from tumour cells plays key roles in the progression of bone invasion by oral squamous cell carcinoma." in: Oncology reports, Vol. 38, Issue 2, pp. 850-858, (2017) (PubMed).

    Jeng, Jeng, Jeng, Sheen, Li, Lu, Chang: "Tropism of liver epithelial cells toward hepatocellular carcinoma in vitro and in vivo with altering gene expression of cancer stem cells." in: American journal of surgery, Vol. 215, Issue 4, pp. 735-743, (2017) (PubMed).

    Li, Zhang, Zhang, Liu, Qi, Zhao, Jiang, Zhai, Ji, Luo: "Stem cell-like circulating tumor cells indicate poor prognosis in gastric cancer." in: BioMed research international, Vol. 2014, pp. 981261, (2015) (PubMed).

    Yin, Tian, Ye, Li, Wang, Cheng, Chen, Guo, Huang: "Nanog and ?-catenin: a new convergence point in EpSC proliferation and differentiation." in: International journal of molecular medicine, Vol. 29, Issue 4, pp. 587-92, (2012) (PubMed).

    Lu, Gu, Xu, Liu, Xie, Song: "Adult islets cultured in collagen gel transdifferentiate into duct-like cells." in: World journal of gastroenterology, Vol. 11, Issue 22, pp. 3426-30, (2005) (PubMed).

  • Target
    Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))
    Alternative Name
    KRT19 (KRT19 Products)
    Synonyms
    CK19 antibody, K19 antibody, K1CS antibody, AI663979 antibody, EndoC antibody, Krt-1.19 antibody, Krt1-19 antibody, Ka19 antibody, k19 antibody, ck19 antibody, k1cs antibody, krt9 antibody, krt15 antibody, MGC76282 antibody, GK-19 antibody, MGC83069 antibody, KRT19 antibody, keratin 19 antibody, keratin 19 L homeolog antibody, keratin, type I cytoskeletal 19 antibody, KRT19 antibody, Krt19 antibody, krt19 antibody, krt19.L antibody, LOC100344434 antibody, LOC101117946 antibody
    Background
    Keratin, type I cytoskeletal 19 is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, KRT19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood.

    Synonyms: 40 kDa keratin intermediate filament antibody|CK 19 antibody|CK-19 antibody|ck19 antibody| Cytokeratin 19 antibody|Cytokeratin-19 antibody|k19 antibody|K1C19_HUMAN antibody|k1cs antibody|Keratin 19 antibody|Keratin type I 40 kD antibody|Keratin type i 40kD antibody| Keratin type I cytoskeletal 19 antibody|Keratin, type I cytoskeletal 19 antibody|Keratin, type I, 40 kd antibody|Keratin-19 antibody|krt19 antibody|mgc15366 antibody
    Gene ID
    3880
    UniProt
    P08727
You are here:
Support