Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

TCP1 alpha/CCTA antibody (C-Term)

TCP1 Reactivity: Human, Mouse, Rat WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN3043417
  • Target See all TCP1 alpha/CCTA (TCP1) Antibodies
    TCP1 alpha/CCTA (TCP1) (T-Complex 1 (TCP1))
    Binding Specificity
    • 58
    • 18
    • 17
    • 15
    • 15
    • 15
    • 9
    • 5
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 515-551, C-Term
    Reactivity
    • 148
    • 121
    • 58
    • 23
    • 21
    • 20
    • 18
    • 18
    • 17
    • 16
    • 13
    • 11
    • 10
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 128
    • 47
    • 19
    • 2
    Rabbit
    Clonality
    • 121
    • 75
    Polyclonal
    Conjugate
    • 69
    • 14
    • 12
    • 11
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    This TCP1 alpha/CCTA antibody is un-conjugated
    Application
    • 147
    • 60
    • 59
    • 46
    • 43
    • 42
    • 40
    • 39
    • 26
    • 20
    • 11
    • 10
    • 3
    • 2
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit IgG polyclonal antibody for T-complex protein 1 subunit alpha(TCP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequence
    KFATEAAITI LRIDDLIKLH PESKDDKHGS YEDAVHS
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for T-complex protein 1 subunit alpha(TCP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: t-complex 1
    Protein Name: T-complex protein 1 subunit alpha
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product TCP1 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Gong, Guo, Huang, Sun: "Inhaled nitric oxide alleviates hyperoxia suppressed phosphatidylcholine synthesis in endotoxin-induced injury in mature rat lungs." in: Respiratory research, Vol. 7, pp. 5, (2006) (PubMed).

  • Target
    TCP1 alpha/CCTA (TCP1) (T-Complex 1 (TCP1))
    Alternative Name
    TCP1 (TCP1 Products)
    Synonyms
    CCT-alpha antibody, CCT1 antibody, CCTa antibody, D6S230E antibody, TCP-1-alpha antibody, AI528772 antibody, CCT antibody, Cct1 antibody, Ccta antibody, TRic antibody, Tcp-1 antibody, Tp63 antibody, c-cpn antibody, p63 antibody, TRiC antibody, CCTalpha antibody, BEST:GH05123 antibody, CG5374 antibody, Dmel\\CG5374 antibody, T-cpl antibody, TCP-1alpha antibody, TCPA_DROME antibody, Tcp1 antibody, Tcp1-alpha antibody, gh05123 antibody, cct-alpha antibody, ccta antibody, tcp1 antibody, tcp1-a antibody, tcp1a antibody, tcp1alpha antibody, CHUNP6875 antibody, fa13h08 antibody, wu:fa13h08 antibody, wu:fc95g06 antibody, t-complex 1 antibody, T-complex protein 1 subunit alpha antibody, t-complex protein 1 antibody, Tcp1-like antibody, t-complex 1 S homeolog antibody, TCP1 antibody, cct-1 antibody, Tcp1 antibody, T-cp1 antibody, tcp1.S antibody, tcp1 antibody
    Background
    T-complex protein 1 subunit alpha is a protein that in humans is encoded by the TCP1 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found.

    Synonyms: AI528772 antibody|c-cpn antibody|CCT alpha antibody|CCT antibody|CCT-alpha antibody|CCT1 antibody|Ccta antibody|CCTalpha antibody| D6S230E antibody|MGC133746 antibody|p63 antibody|T complex 1 antibody|T complex protein 1 alpha subunit antibody|T complex protein 1 antibody|T-complex homolog TCP1 antibody|T-complex protein 1 subunit alpha antibody|T-complex protein 1 subunit alpha B antibody| Tailless complex polypeptide 1 antibody|Tailless complex polypeptide 1A antibody|Tailless complex polypeptide 1B antibody|TCP 1 alpha antibody|Tcp-1 antibody|TCP-1-alpha antibody|TCP1 antibody|TCPA_HUMAN antibody|Tp63 antibody|TRic antibody
    Gene ID
    6950
    UniProt
    P17987
You are here:
Support