KCNA2 antibody (C-Term)
-
- Target See all KCNA2 Antibodies
- KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))
-
Binding Specificity
- AA 466-499, C-Term
-
Reactivity
- Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNA2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 2(KCNA2) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- NNSNEDFREE NLKTANCTLA NTNYVNITKM LTDV
- Cross-Reactivity (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Characteristics
-
Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 2(KCNA2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: potassium channel, voltage gated shaker related subfamily A, member 2
Protein Name: Potassium voltage-gated channel subfamily A member 2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.2 (466-499aa NNSNEDFREENLKTANCTLANTNYVNITKMLTDV), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product KCNA2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))
- Alternative Name
- KCNA2 (KCNA2 Products)
- Synonyms
- KCNA2 antibody, kcna2 antibody, HBK5 antibody, HK4 antibody, HUKIV antibody, KV1.2 antibody, MK2 antibody, NGK1 antibody, RBK2 antibody, Akr6a4 antibody, ENSMUSG00000074335 antibody, Gm10672 antibody, Kca1-2 antibody, Kv1.2 antibody, Mk-2 antibody, BK2 antibody, XSha2 antibody, k(v)1.2 antibody, kcna2-a antibody, kv1.2 antibody, potassium voltage-gated channel subfamily A member 2 antibody, potassium channel, voltage gated shaker related subfamily A, member 1 antibody, potassium voltage-gated channel, shaker-related subfamily, member 2 antibody, potassium channel, voltage gated shaker related subfamily A, member 2 S homeolog antibody, KCNA2 antibody, kcna1 antibody, Kcna2 antibody, LOC100537815 antibody, kcna2.S antibody
- Background
-
Potassium voltage-gated channel subfamily A member 2, also known as Kv1.2, is a protein that in humans is encoded by the KCNA2 gene. Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of this gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1.
Synonyms: Akr6a4 antibody|BK2 antibody|HBK5 antibody|HK4 antibody|HUKIV antibody|Kca1 2 antibody|kcna2 antibody|KV1.2 antibody|MGC50217 antibody|Mk 2 antibody|MK2 antibody|NGK1 antibody|Potassium voltage gated channel shaker related subfamily member 2 antibody|Potassium voltage-gated channel subfamily A member 2 antibody|RBK2 antibody|Voltage gated potassium channel subunit Kv1.2 antibody - Gene ID
- 3737
- UniProt
- P16389
-