Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309634

Methyl-CpG Binding Domain Protein 1 (MBD1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RFT, PCM1, CXXC3, Cxxc3
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309634
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MBD1 antibody: synthetic peptide directed towards the C terminal of human MBD1
Sequence NKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVW LPRSKDLKKP
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Mouse : 85%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against MBD1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MBD1
Background MBD1 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD1 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters, in addition, variants with three CXXC domains also repress unmethylated promoter activity. DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters, in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21.DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters, in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21.
Molecular Weight 60kDa
Gene ID 4152
NCBI Accession NP_056669, NM_015844
UniProt Q9UIS9-3
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MBD1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Villa, Morey, Raker et al.: "The methyl-CpG binding protein MBD1 is required for PML-RARalpha function." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 5, pp. 1400-5, 2006 (PubMed).

Alternatives for antigen "Methyl-CpG Binding Domain Protein 1 (MBD1)", type "Antibodies"
Hosts (38), (16)
Reactivities (52), (17), (15), (1), (1)
Applications (44), (16), (10), (6), (3), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (5), (3), (3), (2), (2), (2), (1), (1), (1)
Beacon