Did you know that you can buy products from over 140 different suppliers from us?

Methyl-CpG Binding Domain Protein 1 (MBD1) (C-Term) antibody

Details for Product No. ABIN309634
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CXXC3, PCM1, RFT, Cxxc3
Epitope
C-Term
(7), (5), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(51), (16), (14), (1), (1)
Host
Rabbit
(39), (14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(43), (13), (10), (6), (3), (3), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309634
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human MBD1
Sequence NKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVW LPRSKDLKKP
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Mouse : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against MBD1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MBD1
Background MBD1 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD1 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters, in addition, variants with three CXXC domains also repress unmethylated promoter activity. DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters, in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21.DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters, in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21.
Molecular Weight 60 kDa
Gene ID 4152
NCBI Accession NM_015844, NP_056669
UniProt Q9UIS9-3
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 549 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Methyl-CpG Binding Domain Protein 1 (MBD1) (C-Term) antibody WB Suggested Anti-MBD1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Villa, Morey, Raker et al.: "The methyl-CpG binding protein MBD1 is required for PML-RARalpha function." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 5, pp. 1400-5, 2006 (PubMed).

Validation Images
back to top