Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309653

Transducin-Like Enhancer of Split 2 (E(sp1) Homolog, Drosophila) (TLE2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ESG, ESG2, GRG2, Grg2, mKIAA4188, TLE2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309653
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TLE2 antibody: synthetic peptide directed towards the N terminal of human TLE2
Sequence VEEERPSGPGGGGKQRADEKEPSGPYESDEDKSDYNLVVD EDQPSEPPSP
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 84%, Rat : 84%
Characteristics This is a rabbit polyclonal antibody against TLE2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TLE2
Background TLE2 belongs to the WD repeat Groucho/TLE family. It contains 6 WD repeats. TLE2 is a transcriptional corepressor that binds to a number of transcription factors. It inhibits the transcriptional activation mediated by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES.
Molecular Weight 80kDa
Gene ID 7089
NCBI Accession NP_003251, NM_003260
UniProt Q04725
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TLE2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Higa, Wu, Ye et al.: "CUL4-DDB1 ubiquitin ligase interacts with multiple WD40-repeat proteins and regulates histone methylation." in: Nature cell biology, Vol. 8, Issue 11, pp. 1277-83, 2006 (PubMed).

Alternatives for antigen "Transducin-Like Enhancer of Split 2 (E(sp1) Homolog, Drosophila) (TLE2)", type "Antibodies"
Hosts (21), (3)
Reactivities (22), (4)
Applications (24), (13), (2), (1), (1), (1)
Epitopes (5), (4), (2), (2), (1), (1), (1), (1)
Beacon