Transducin-Like Enhancer of Split 2 (E(sp1) Homolog, Drosophila) (TLE2) (N-Term) antibody

Details for Product No. ABIN309653
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ESG, ESG2, GRG2, Grg2, mKIAA4188, TLE2
Epitope
N-Term
(5), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(23), (1)
Host
Rabbit
(20), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(23), (14), (2), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN309653
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TLE2
Sequence VEEERPSGPGGGGKQRADEKEPSGPYESDEDKSDYNLVVD EDQPSEPPSP
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against TLE2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TLE2
Background TLE2 belongs to the WD repeat Groucho/TLE family. It contains 6 WD repeats. TLE2 is a transcriptional corepressor that binds to a number of transcription factors. It inhibits the transcriptional activation mediated by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES.
Molecular Weight 80 kDa
Gene ID 7089
NCBI Accession NM_003260, NP_003251
UniProt Q04725
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 743 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Higa, Wu, Ye et al.: "CUL4-DDB1 ubiquitin ligase interacts with multiple WD40-repeat proteins and regulates histone methylation." in: Nature cell biology, Vol. 8, Issue 11, pp. 1277-83, 2006 (PubMed).

Hosts (20), (3)
Reactivities (23), (1)
Applications (23), (14), (2), (1), (1), (1)
Epitopes (5), (2), (1), (1), (1), (1), (1), (1), (1)
back to top