Thymus High Mobility Group Box Protein (TOX) (N-Term) antibody

Details for Product No. ABIN309708
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1700007F02Rik, TOX1
Epitope
N-Term
(8)
Reactivity
Mouse (Murine), Dog (Canine), Rat (Rattus), Cow (Bovine), Human, Chicken
(10), (1), (1), (1), (1), (1)
Host
Rabbit
(10)
Clonality
Polyclonal
Application
Western Blotting (WB)
(10), (6), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN309708
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TOX
Sequence CLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLES EDFNIPPITP
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Chicken : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against TOX. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TOX
Background Some high-mobility group (HMG) box proteins (e.g., LEF1) contain a single HMG box motif and bind DNA in a sequence-specific manner, while other members of this family (e.g., HMG1) have multiple HMG boxes and bind DNA in a sequence-independent but structure-dependent manner. All HMG box proteins are able to induce a sharp bend in DNA. TOX contains a single HMG box motif.Some high-mobility group (HMG) box proteins (e.g., LEF1, MIM 153245) contain a single HMG box motif and bind DNA in a sequence-specific manner, while other members of this family (e.g., HMG1, MIM 163905) have multiple HMG boxes and bind DNA in a sequence-independent but structure-dependent manner. All HMG box proteins are able to induce a sharp bend in DNA. TOX contains a single HMG box motif.
Molecular Weight 58 kDa
Gene ID 9760
NCBI Accession NM_014729, NP_055544
UniProt O94900
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 526 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Thymus High Mobility Group Box Protein (TOX) (N-Term) antibody WB Suggested Anti-TOX Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Aliahmad, OFlaherty, Han et al.: "TOX provides a link between calcineurin activation and CD8 lineage commitment." in: The Journal of experimental medicine, Vol. 199, Issue 8, pp. 1089-99, 2004 (PubMed).

Hosts (10)
Reactivities (10), (1), (1), (1), (1), (1)
Applications (10), (6), (2), (1), (1)
Epitopes (8)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top