Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309708

Thymus High Mobility Group Box Protein (TOX) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1700007F02Rik, TOX1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Rat (Rattus), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309708
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TOX antibody: synthetic peptide directed towards the N terminal of human TOX
Sequence CLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLES EDFNIPPITP
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Chicken : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against TOX. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TOX
Background Some high-mobility group (HMG) box proteins (e.g., LEF1) contain a single HMG box motif and bind DNA in a sequence-specific manner, while other members of this family (e.g., HMG1) have multiple HMG boxes and bind DNA in a sequence-independent but structure-dependent manner. All HMG box proteins are able to induce a sharp bend in DNA. TOX contains a single HMG box motif.Some high-mobility group (HMG) box proteins (e.g., LEF1, MIM 153245) contain a single HMG box motif and bind DNA in a sequence-specific manner, while other members of this family (e.g., HMG1, MIM 163905) have multiple HMG boxes and bind DNA in a sequence-independent but structure-dependent manner. All HMG box proteins are able to induce a sharp bend in DNA. TOX contains a single HMG box motif.
Molecular Weight 58kDa
Gene ID 9760
NCBI Accession NP_055544, NM_014729
UniProt O94900
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TOX antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Aliahmad, OFlaherty, Han et al.: "TOX provides a link between calcineurin activation and CD8 lineage commitment." in: The Journal of experimental medicine, Vol. 199, Issue 8, pp. 1089-99, 2004 (PubMed).

Alternatives for antigen "Thymus High Mobility Group Box Protein (TOX)", type "Antibodies"
Hosts (9)
Reactivities (9), (1), (1), (1), (1), (1)
Applications (9), (5), (2), (1), (1)
Epitopes (7)
Beacon