Did you know that you can buy products from over 140 different suppliers from us?

Splicing Factor 3a, Subunit 1 (SF3A1) (N-Term) antibody

Details for Product No. ABIN310053
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
AI159724, 1200014H24Rik, 5930416L09Rik, Dmel\\CG16941, SF3a1, SF3a120, si:dz150f13.2, wu:fc38e01, wu:fc50a11, wu:fj37c05, zgc:65786, PRP21, PRPF21, SAP114, SF3A120, DDBDRAFT_0168938, DDBDRAFT_0233180, ... show more
AI159724, 1200014H24Rik, 5930416L09Rik, Dmel\\CG16941, SF3a1, SF3a120, si:dz150f13.2, wu:fc38e01, wu:fc50a11, wu:fj37c05, zgc:65786, PRP21, PRPF21, SAP114, SF3A120, DDBDRAFT_0168938, DDBDRAFT_0233180, DDB_0168938, DDB_0233180 show less
Epitope
N-Term
(3), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Fruit Fly (Drosophila melanogaster), Dog (Canine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
(21), (5), (5), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(15), (8)
Clonality
Polyclonal
Application
Immunofluorescence (IF), Western Blotting (WB)
(21), (8), (7), (5), (4), (4), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310053
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SF3A1
Sequence QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSIS AFDLDVVKLT
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against SF3A1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SF3A1
Background SF3A1 is the subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family, named for the SURP motifs that are thought to mediate RNA binding. Subunit 1 has tandemly repeated SURP motifs in its amino-terminal half while its carboxy-terminal half contains a proline-rich region and a ubiquitin-like domain. Binding studies with truncated subunit 1 derivatives demonstrated that the two SURP motifs are necessary for binding to subunit 3 while contacts with subunit 2 may occur through sequences carboxy-terminal to the SURP motifs.This gene encodes subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family, named for the SURP (also called SWAP or Suppressor-of-White-APricot) motifs that are thought to mediate RNA binding. Subunit 1 has tandemly repeated SURP motifs in its amino-terminal half while its carboxy-terminal half contains a proline-rich region and a ubiquitin-like domain. Binding studies with truncated subunit 1 derivatives demonstrated that the two SURP motifs are necessary for binding to subunit 3 while contacts with subunit 2 may occur through sequences carboxy-terminal to the SURP motifs. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Weight 89 kDa
Gene ID 10291
NCBI Accession NM_005877, NP_005868
UniProt Q15459
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 793 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Splicing Factor 3a, Subunit 1 (SF3A1) (N-Term) antibody WB Suggested Anti-SF3A1 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (15), (8)
Reactivities (21), (5), (5), (1), (1), (1), (1), (1), (1)
Applications (21), (8), (7), (5), (4), (4), (1)
Epitopes (3), (2), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310053
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top