Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310064

Poly(A) Binding Protein Interacting Protein 1 (PAIP1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms fb53g01, zgc:91954, wu:fb53g01
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310064
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PAIP1 antibody: synthetic peptide directed towards the N terminal of human PAIP1
Sequence MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVV VAPVLMSKLS
Predicted Reactivity Human : 100%, Mouse : 100%, Rat : 100%, Guinea pig : 92%, Dog : 85%, Bovine : 84%, Horse : 78%, Pig : 78%
Characteristics This is a rabbit polyclonal antibody against PAIP1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PAIP1
Background PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation.The protein encoded by this gene interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified.The protein encoded by this gene interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified.
Molecular Weight 46kDa
Gene ID 10605
NCBI Accession NP_877590, NM_182789
UniProt Q9H074-2
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PAIP1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Fortna, Kim, MacLaren et al.: "Lineage-specific gene duplication and loss in human and great ape evolution." in: PLoS biology, Vol. 2, Issue 7, pp. E207, 2004 (PubMed).

Alternatives for antigen "Poly(A) Binding Protein Interacting Protein 1 (PAIP1)", type "Antibodies"
Hosts (12), (4)
Reactivities (14), (3), (3), (1), (1), (1), (1)
Applications (16), (7), (3), (2)
Epitopes (4), (3), (3), (2)
Beacon