Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310084

Cleavage and Polyadenylation Specific Factor 2, 100kDa (CPSF2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
Cpsf, MCPSF, 100kDa, AI662483, mKIAA1367, 2610024B04Rik, CPSF100, cpsf2-A, zgc:92484, ATCPSF100, CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR, CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR 100, E ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310084
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CPSF2 antibody: synthetic peptide directed towards the N terminal of human CPSF2
Sequence YAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFT LFTLDDVDAA
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against CPSF2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CPSF2
Background CPSF2 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. It belongs to the metallo-beta-lactamase superfamily, RNA-metabolizing metallo-beta-lactamase-like family, CPSF2/YSH1 subfamily.
Molecular Weight 88kDa
Gene ID 53981
NCBI Accession NP_059133, NM_017437
UniProt Q9P2I0
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CPSF2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Cleavage and Polyadenylation Specific Factor 2, 100kDa (CPSF2)", type "Antibodies"
Hosts (12), (6)
Reactivities (15), (3), (2), (1), (1)
Applications (14), (5), (3), (2), (2), (2), (2), (1), (1)
Epitopes (1), (1), (1)
Beacon