Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310093

TIA1 Cytotoxic Granule-Associated RNA Binding Protein (TIA1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TIA-1, WDM, mTIA-1, AI256674, 2310050N03Rik, tia-1, tia1
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310093
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TIA1 antibody: synthetic peptide directed towards the C terminal of human TIA1
Sequence QAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPS GYRVAGYETQ
Predicted Reactivity Human : 100%, Dog : 92%, Horse : 92%, Mouse : 92%, Rabbit : 92%, Rat : 92%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against TIA1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TIA1
Background TIA1 is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing.The product encoded by this gene is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing. Alternative splicing resulting in different isoforms of this gene product has been described in the literature.
Molecular Weight 42kDa
Gene ID 7072
NCBI Accession NP_071320, NM_022037
UniProt P31483-2
Research Area Chromatin and Nuclear Signaling, DNA/RNA, Adaptive Immunity, Apoptosis/Necrosis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TIA1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications López de Silanes, Galbán, Martindale et al.: "Identification and functional outcome of mRNAs associated with RNA-binding protein TIA-1." in: Molecular and cellular biology, Vol. 25, Issue 21, pp. 9520-31, 2005 (PubMed).

Alternatives for antigen "TIA1 Cytotoxic Granule-Associated RNA Binding Protein (TIA1)", type "Antibodies"
Hosts (22), (10), (8)
Reactivities (34), (17), (16), (14), (11), (1), (1)
Applications (24), (11), (11), (9), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (3), (3), (1)
Beacon