DHOdehase (N-Term) antibody

Details for Product No. ABIN310241
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms DHOdehase, POADS, URA1, CG9741, DHOD, DHODH, Dmel\\CG9741, dhod, l(3)s3512, wu:fc29a01, zgc:103492
Epitope
N-Term
(6), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(28), (6), (6), (3), (3), (2), (2), (1)
Host
Rabbit
(29), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(31), (10), (9), (4), (2), (2)
Pubmed 2 references available
Catalog no. ABIN310241
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DHODH
Sequence GEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQ AVINRYGFNS
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Bovine : 90 %, Guinea pig : 90 %, Mouse : 90 %, Rabbit : 90 %, Rat : 90 %, Chicken : 80 %, Zebrafish : 80 %, African clawed frog : 70 %
Characteristics This is a rabbit polyclonal antibody against DHODH. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DHODH
Background DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 43 kDa
Gene ID 1723
NCBI Accession NM_001361, NP_001352
UniProt Q02127
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 395 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-DHOdehase (N-Term) antibody WB Suggested Anti-DHODH Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Hosts (29), (3)
Reactivities (28), (6), (6), (3), (3), (2), (2), (1)
Applications (31), (10), (9), (4), (2), (2)
Epitopes (6), (2), (2), (1), (1), (1), (1), (1)
back to top