Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310418

Cell Division Cycle 23 Homolog (S. Cerevisiae) (CDC23) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ANAPC8, APC8, CUT23, 6030435O18, D18Ertd243e, zgc:56013, CDC23, anaphase-promoting complex subunit 8
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310418
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CDC23 antibody: synthetic peptide directed towards the C terminal of human CDC23
Sequence DTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSAN NTPTRRVSPL
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against CDC23. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CDC23
Background CDC23 shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eukaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction.The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction.
Molecular Weight 65kDa
Gene ID 8697
NCBI Accession NP_004652, NM_004661
UniProt Q9UJX2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CDC23 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Alternatives for antigen "Cell Division Cycle 23 Homolog (S. Cerevisiae) (CDC23)", type "Antibodies"
Hosts (51), (1)
Reactivities (48), (34), (24), (13), (13), (12), (12), (1), (1)
Applications (39), (24), (10), (10), (7), (4), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (9), (4), (2), (1), (1), (1), (1), (1)
Beacon