Did you know that you can buy products from over 140 different suppliers from us?

Osteoactivin (N-Term) antibody

Details for Product No. ABIN310605
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ipd, Dchil, DC-HIL, NMB, HGFIN
Epitope
N-Term
(7), (6), (5), (5), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Dog (Canine), Human
(42), (23), (21), (18), (18), (17), (1), (1)
Host
Rabbit
(37), (10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(26), (25), (15), (14), (7), (6)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310605
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human GPNMB
Sequence DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPAL VGSNITFAVN
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Guinea pig : 90 %, Pig : 90 %, Rat : 90 %, Dog : 70 %
Characteristics This is a rabbit polyclonal antibody against GPNMB. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name GPNMB
Background GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential.The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 60 kDa
Gene ID 10457
NCBI Accession NM_002510, NP_002501
UniProt A8K7R3
Research Area Cancer, Innate Immunity
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 560 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Osteoactivin (N-Term) antibody anti-Osteoactivin (N-Term) antibody
anti-Osteoactivin (N-Term) antibody (2) anti-Osteoactivin (N-Term) antibody (Image 2)
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310605
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top