CDGSH Iron Sulfur Domain 2 (CISD2) antibody

Antigen: CDGSH Iron Sulfur Domain 2 (CISD2)

Synonyms: Zcd2, Miner1, Noxp70, AI848398, 1500009M05Rik, 1500026J14Rik, 1500031D15Rik, B630006A20Rik, RGD1566242, MGC64148, zgc:64148, eris, wfs2, zcd2, miner1, MGC69148, ZCD2, cisd2, MGC82817, ERIS, WFS2, MGC142830, cisd2b

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN310609

Additional Information

Alternative name: CISD2

Gene ID: CISD2

UniProt: Q8N5K1

Immunogen: The immunogen for anti-CISD2 antibody: synthetic peptide directed towards the N terminal of human CISD2

Sequence: VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRL LPFLGVLALL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CISD2 antibody concentration is 1 mg/ml.

Description: CISD2 is a zinc finger protein that localizes to the endoplasmic reticulum. It binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2 (WFS2).

Characteristics: Antigen Size: 135 amino acids

Molecular Weight: 15kDa

Synonyms: Zcd2, Miner1, Noxp70, AI848398, 1500009M05Rik, 1500026J14Rik, 1500031D15Rik, B630006A20Rik, RGD1566242, MGC64148, zgc:64148, eris, wfs2, zcd2, miner1, MGC69148, ZCD2, cisd2, MGC82817, ERIS, WFS2, MGC142830, cisd2b

Application Details

Application Notes: WB Suggested Anti-CISD2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-CISD2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T

Publications

Product: Amr, Heisey, Zhang et al.: "A homozygous mutation in a novel zinc-finger protein, ERIS, is responsible for Wolfram syndrome 2." in: American journal of human genetics, Vol. 81, Issue 4, pp. 673-83, 2007 (PubMed).