Did you know that you can buy products from over 140 different suppliers from us?

Kynureninase (L-Kynurenine Hydrolase) (KYNU) (C-Term) antibody

Details for Product No. ABIN310755
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BA2753, 4432411A05Rik
Epitope
C-Term
(2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(18), (4), (3), (1)
Host
Rabbit
(14), (6), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(20), (6), (4), (3), (3), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310755
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human KYNU
Sequence LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFI HEKHAHTIKP
Predicted Reactivity Human : 100 %, Guinea pig : 90 %, Horse : 90 %, Yeast : 90 %, Bovine : 80 %, Dog : 80 %, Mouse : 80 %, Rabbit : 80 %, Rat : 80 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against KYNU. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name KYNU
Background Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway.Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Two transcript variants encoding different isoforms have been found for this gene.Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 52 kDa
Gene ID 8942
NCBI Accession NM_003937, NP_003928
UniProt Q16719
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 465 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Kynureninase (L-Kynurenine Hydrolase) (KYNU) (C-Term) antibody WB Suggested Anti-KYNU Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Validation Images
back to top