Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310755

Kynureninase (L-Kynurenine Hydrolase) (KYNU) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4432411A05Rik, BA2753
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310755
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KYNU antibody: synthetic peptide directed towards the C terminal of human KYNU
Sequence LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFI HEKHAHTIKP
Predicted Reactivity Human : 100%, Guinea pig : 92%, Horse : 92%, Yeast : 92%, Bovine : 85%, Dog : 85%, Mouse : 85%, Rabbit : 85%, Rat : 85%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against KYNU. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name KYNU
Background Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway.Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Two transcript variants encoding different isoforms have been found for this gene.Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 52kDa
Gene ID 8942
NCBI Accession NP_003928, NM_003937
UniProt Q16719
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KYNU antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives for antigen "Kynureninase (L-Kynurenine Hydrolase) (KYNU)", type "Antibodies"
Hosts (14), (5)
Reactivities (17), (3), (3), (1)
Applications (18), (8), (6), (3), (2), (2), (1)
Epitopes (5), (2), (2), (2), (2), (1), (1), (1)
Beacon