serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1) antibody

Antigen: serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1)

Synonyms: HSAN, HSN1, LBC1, LCB1, SPT1, SPTI, HSAN1, MGC14645, Lcb1, C77762, AW552086, E030036H05, Spt1, RGD1306617, ATSPT1, SERINE PALMITOYLTRANSFERASE 1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Xenopus laevis, Dog (Canine), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN310841

Additional Information

Alternative name: SPTLC1

Gene ID: SPTLC1

UniProt: O15269

Immunogen: The immunogen for anti-SPTLC1 antibody: synthetic peptide directed towards the middle region of human SPTLC1

Sequence: ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHY GINIDDIDLI

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SPTLC1 antibody concentration is 1 mg/ml.

Description: Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. SPTLC1 is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in SPTLC1 gene were identified in patients with hereditary sensory neuropathy type 1.Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. The product of this gene is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in this gene were identified in patients with hereditary sensory neuropathy type 1. Alternatively spliced variants encoding different isoforms have been identified.

Characteristics: Antigen Size: 473 amino acids

Molecular Weight: 53kDa

Application Details

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Cancer, Metabolism

Restrictions: For Research Use only

Images

anti-serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1) antibody

anti-serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1) antibody (Image 2)

anti-serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1) antibody (Image 3)

Publications

Product: McCampbell, Truong, Broom et al.: "Mutant SPTLC1 dominantly inhibits serine palmitoyltransferase activity in vivo and confers an age-dependent neuropathy." in: Human molecular genetics, Vol. 14, Issue 22, pp. 3507-21, 2005 (PubMed).