Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311017

Malate Dehydrogenase 1, NAD (Soluble) (MDH1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MDHA, MOR2, MDH-s, MGC:1375, Mor2, Mor-2, D17921, B230377B03Rik, MDL1, Mdhl, MDH, mdh-s, mdha, mor2, MDH-1, Mdh, Mdh-1, Mdh2, MdhD, cMdh, sMdh
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Arabidopsis, Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311017
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MDH1 antibody: synthetic peptide directed towards the middle region of human MDH1
Sequence NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSST QYPDVNHAKV
Predicted Reactivity Guinea pig : 100%, Human : 100%, Pig : 100%, Dog : 92%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against MDH1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name MDH1
Background Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH1 is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.
Molecular Weight 36kDa
Gene ID 4190
NCBI Accession NP_005908, NM_005917
UniProt P40925
Research Area Cancer, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MDH1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives for antigen "Malate Dehydrogenase 1, NAD (Soluble) (MDH1)", type "Antibodies"
Hosts (35), (19), (10), (5)
Reactivities (49), (34), (18), (17), (15), (13), (12), (2), (2), (2), (1)
Applications (60), (52), (19), (15), (12), (12), (10), (10), (9), (9), (7), (3), (3), (2), (1), (1)
Conjugates (8), (6), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (4), (3), (2), (2), (2), (1), (1), (1), (1)
Beacon