Phosphatidylglycerophosphate Synthase 1 (PGS1) (C-Term) antibody

Details for Product No. ABIN311100
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2610019F11Rik, 4933424M23Rik, SAF, RGD1305052
Epitope
C-Term
(7), (3), (2), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Human, Chicken
(16), (4), (4), (1), (1), (1)
Host
Rabbit
(17), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(18), (8), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN311100
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human PGS1
Sequence QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQ VKLWVKMVTP
Predicted Reactivity Guinea pig : 100 %, Human : 100 %, Dog : 90 %, Horse : 90 %, Rat : 90 %, Mouse : 80 %
Characteristics This is a rabbit polyclonal antibody against PGS1. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name PGS1
Background PGS1 functions in the biosynthesis of the anionic phospholipids phosphatidylglycerol and cardiolipin.
Molecular Weight 63 kDa
Gene ID 9489
NCBI Accession NM_024419, NP_077733
UniProt Q32NB8
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 556 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Phosphatidylglycerophosphate Synthase 1 (PGS1) (C-Term) antibody WB Suggested Anti-PGS1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Simpson, Wellenreuther, Poustka et al.: "Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing." in: EMBO reports, Vol. 1, Issue 3, pp. 287-92, 2001 (PubMed).

Hosts (17), (1)
Reactivities (16), (4), (4), (1), (1), (1)
Applications (18), (8), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (7), (3), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top