Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311100

Phosphatidylglycerophosphate Synthase 1 (PGS1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2610019F11Rik, 4933424M23Rik, SAF, RGD1305052
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN311100
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PGS1 antibody: synthetic peptide directed towards the C terminal of human PGS1
Sequence QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQ VKLWVKMVTP
Predicted Reactivity Guinea pig : 100%, Human : 100%, Dog : 92%, Horse : 92%, Rat : 92%, Mouse : 85%
Characteristics This is a rabbit polyclonal antibody against PGS1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name PGS1
Background PGS1 functions in the biosynthesis of the anionic phospholipids phosphatidylglycerol and cardiolipin.
Molecular Weight 63kDa
Gene ID 9489
NCBI Accession NP_077733, NM_024419
UniProt Q32NB8
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PGS1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Simpson, Wellenreuther, Poustka et al.: "Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing." in: EMBO reports, Vol. 1, Issue 3, pp. 287-92, 2001 (PubMed).

Alternatives for antigen "Phosphatidylglycerophosphate Synthase 1 (PGS1)", type "Antibodies"
Hosts (10), (1)
Reactivities (9), (3), (3), (1), (1), (1)
Applications (11), (4), (2), (2), (1)
Epitopes (3), (2), (1), (1), (1), (1)
Beacon