Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3) (N-Term) antibody

Details for Product No. ABIN311489
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARC21, p21-Arc, 21kDa, p21-Ar, p21Arc, AA408672, AI788639, 1110006A04Rik, zgc:86828, DDBDRAFT_0184576, DDBDRAFT_0201632, DDB_0184576, DDB_0201632, arc21, p21-arc
Epitope
N-Term
(5), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Dog (Canine), Pig (Porcine), Zebrafish (Danio rerio), Human, Chicken
(27), (7), (5), (2), (1), (1)
Host
Rabbit
(22), (6), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2)
Application
Western Blotting (WB)
(29), (17), (9), (4), (1)
Pubmed 1 reference available
Catalog no. ABIN311489
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ARPC3
Sequence MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTD IVDEAIYYFK
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against ARPC3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ARPC3
Background ARPC3 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein, the p21 subunit, has yet to be determined.This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p21 subunit, has yet to be determined.
Molecular Weight 20 kDa
Gene ID 10094
NCBI Accession NM_005719, NP_005710
UniProt O15145
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 178 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3) (N-Term) antibody WB Suggested Anti-ARPC3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (22), (6), (2)
Reactivities (27), (7), (5), (2), (1), (1)
Applications (29), (17), (9), (4), (1)
Conjugates (2), (2), (2)
Epitopes (5), (1), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top