Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311489

Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARC21, p21-Arc, 21kDa, p21-Ar, p21Arc, AA408672, AI788639, 1110006A04Rik, zgc:86828, DDBDRAFT_0184576, DDBDRAFT_0201632, DDB_0184576, DDB_0201632, arc21, p21-arc
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Dog (Canine), Pig (Porcine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311489
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ARPC3 antibody: synthetic peptide directed towards the N terminal of human ARPC3
Sequence MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTD IVDEAIYYFK
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against ARPC3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ARPC3
Background ARPC3 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein, the p21 subunit, has yet to be determined.This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p21 subunit, has yet to be determined.
Molecular Weight 20kDa
Gene ID 10094
NCBI Accession NP_005710, NM_005719
UniProt O15145
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ARPC3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3)", type "Antibodies"
Hosts (19), (7), (2)
Reactivities (24), (6), (4), (3), (1), (1), (1)
Applications (27), (15), (6), (4), (1), (1)
Conjugates (1), (1), (1)
Epitopes (7), (2), (1), (1), (1), (1), (1), (1)
Beacon